Recombinant Sensor protein CiaH (ciaH)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Sensor protein CiaH (CiaH) is a sensor histidine kinase found in Streptococcus pneumoniae and other streptococci species . CiaH is a two-component system (TCS) sensor protein that, along with its cognate response regulator CiaR, regulates various cellular processes, including competence, stress responses, and virulence .

Function and Mechanism

CiaH is a membrane-bound sensor kinase that detects environmental signals and, in response, phosphorylates its cognate response regulator, CiaR . Once phosphorylated, CiaR modulates the expression of target genes, thereby controlling various cellular functions . The CiaRH system is involved in:

  • Competence: CiaRH system activation prevents the development of competence for genetic transformation in Streptococcus pneumoniae .

  • Stress Responses: CiaH is involved in responses to acid and oxidative stresses in Streptococcus pyogenes . The contribution of CiaH to oxidative stress tolerance is mediated by the HtrA protein in S. pneumoniae .

  • Virulence: CiaRH two-component regulatory systems in S. mutans and S. pneumoniae are known to be involved in regulating virulence .

In Streptococcus mutans, deletion of ciaH results in overexpression of ciaR . Overexpressed CiaR acts as a positive regulator for the expression of the ciaXRH operon, as well as a variety of other downstream targets, and a negative regulator for late competence genes and competence-associated bacteriocin-like genes .

Research Findings

  • Regulation of the ciaXRH Operon: In S. mutans, CiaH affects the transcription of the ciaXRH operon, and when ciaH is absent, expression of ciaR and the ciaXRH operon is increased .

  • CiaR Regulon: Microarray and bioinformatic analyses have identified a CiaR regulon consisting of at least 8 genes/operons that are all positively regulated by CiaR .

  • Binding Site: In vitro DNA footprinting confirmed the CiaR binding site, with a protected region of 26 to 28 bp encompassing two direct repeats, NTTAAG-n5-WTTAAG, 10 bp upstream of the -10 region .

  • HtrA Protein Mediation: The contribution of the CiaH sensor kinase to oxidative stress tolerance is mediated by the HtrA protein in S. pneumoniae .

Data Tables

Table 1: Expression of CiaR Regulon Genes in ciaH Mutant Over Wild Type

Gene/OperonFold Increase in ciaH Mutant
(Data Unavailable)(Data Unavailable)

Note: There is no available data regarding the CiaR Regulon genes fold increase in the ciaH mutant.

Table 2: CiaR Regulon

Gene/OperonRegulation by CiaR
(Data Unavailable)(Data Unavailable)

Note: There is no available data regarding the CiaR Regulon genes and their regulation.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and inherent protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
ciaH; SP_0799; Sensor protein CiaH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-444
Protein Length
full length protein
Species
Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Target Names
ciaH
Target Protein Sequence
MFSKLKKTWYADDFSYFIRNFGVFTLIFSTMTLIILQVMHSSLYTSVDDKLHGLSENPQA VIQLAINRATEEIKDLENARADASKVEIKPNVSSNTEVILFDKDFTQLLSGNRFLGLDKI KLEKKELGHIYQIQVFNSYGQEEIYRVILMETNISSVSTNIKYAAVLINTSQLEQASQKH EQLIVVVMASFWILSLLASLYLARVSVRPLLESMQKQQSFVENASHELRTPLAVLQNRLE TLFRKPEATIMDVSESIASSLEEVRNMRFLTTSLLNLARRDDGIKPELAEVPTSFFNTTF TNYEMIASENNRVFRFENRIHRTIVTDQLLLKQLMTILFDNAVKYTEEDGEIDFLISATD RNLYLLVSDNGIGISTEDKKKIFDRFYRVDKARTRQKGGFGLGLSLAKQIVDALKGTVTV KDNKPKGTIFEVKIAIQTPSKKKK
Uniprot No.

Target Background

Function

CiaH is a member of the two-component regulatory system CiaH/CiaR. It plays a role in the early stages of competence regulation and influences penicillin susceptibility. CiaH is believed to phosphorylate CiaR.

Database Links

KEGG: spn:SP_0799

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is CiaH and what role does it play in bacterial systems?

CiaH is a histidine protein kinase that functions as part of the ciaRH two-component signal-transducing system (TCSTS) in bacterial species. In Streptococcus pneumoniae, it was the first of 13 such systems to be identified . The CiaH protein contains two membrane-spanning regions that separate the N-terminal external sensor domain from the cytoplasmic kinase domain, allowing it to sense external stimuli and transmit signals to its cognate response regulator, CiaR . This system plays a critical role in bacterial adaptation to environmental changes, particularly in maintaining cell wall integrity, antibiotic resistance, and regulation of genetic competence.

How does the CiaRH two-component system function in signal transduction?

The CiaRH system functions as a typical bacterial two-component signal-transducing system where CiaH acts as the sensor histidine kinase and CiaR serves as the response regulator. When CiaH detects specific environmental signals, it autophosphorylates and subsequently transfers the phosphate group to CiaR . Once phosphorylated, CiaR can bind to specific DNA sequences in the promoter regions of target genes, thereby regulating their expression . The genes are arranged in an operon with an 8-bp overlap, suggesting coordinated expression . This system mediates adaptive responses to environmental signals by translating external stimuli into cellular responses through altered gene expression profiles.

What phenotypes are associated with CiaH mutations in different bacterial species?

In Streptococcus pneumoniae, mutations in the ciaH gene confer increased resistance to beta-lactam antibiotics, suggesting that the CiaRH system controls genes involved in bacterial cell wall biochemistry . These mutations also interfere with the development of genetic competence . Additional phenotypes in cia mutants include growth defects associated with early lysis tendencies and attenuated virulence, indicating the importance of this system in maintaining cell wall integrity .

In Streptococcus mutans, inactivation of the ciaH gene results in a total loss of mutacin I production while having no significant effect on mutacin IV or mutacin II production . This suggests that CiaH specifically affects lantibiotic mutacin production in this species, and that different mutacins may be controlled by distinct regulatory mechanisms .

How does CiaH regulate bacterial competence development?

The relationship between CiaH and competence development has been well-documented in both S. pneumoniae and S. mutans. In S. pneumoniae, the CiaRH system appears to repress competence development, as insertional inactivation of ciaR and ciaH results in derepression of competence in both aerobic and microaerobic cultures . The competence regulon, including the comCDE operon required for competence induction, is completely repressed by the active cia system .

The mechanism involves interaction with the ComCDE system, which is responsible for competence induction. When the CSP peptide (processed product of comC) is recognized by the histidine protein kinase ComD, the response regulator ComE activates the comCDE operon and other early genes, including the transcriptional activators ComX1 and ComX2, which then induce late competence genes . The CiaRH system appears to interfere with this cascade, though the exact molecular details of this interference remain an active area of research.

What is the relationship between CiaH function and antibiotic resistance?

Mutations in the ciaH gene confer increased resistance to beta-lactam antibiotics in S. pneumoniae, revealing a novel pathway for resistance development . This suggests that the CiaRH system regulates genes involved in cell wall biochemistry, particularly at steps prior to the biosynthetic functions of penicillin-binding proteins during the final assembly of peptidoglycan . The specific molecular mechanisms by which CiaH mutations lead to antibiotic resistance likely involve altered expression of genes responsible for cell wall synthesis and modification, though the complete set of these genes is still being characterized.

The identification of the CiaR regulon through methods such as solid-phase DNA binding assays and oligonucleotide microarray analysis has revealed that genes important for the synthesis and modification of cell wall polymers are among the targets of this regulatory system , providing further evidence for its role in antibiotic resistance.

What techniques are used to identify genes regulated by the CiaRH system?

Researchers have employed several sophisticated techniques to identify the CiaR regulon:

  • Solid-phase DNA binding assay: This method isolates DNA fragments targeted by the response regulator CiaR from restricted chromosomal DNA .

  • Oligonucleotide microarray analysis: DNA fragments isolated through binding assays are analyzed by hybridization to microarrays representing the bacterial genome to identify potential target sites .

  • Transcription profile analysis: Comparing gene expression patterns between cia loss-of-function mutants and strains with an activated cia system helps confirm CiaR-dependent expression .

Through these approaches, researchers have identified 18 chromosomal regions containing 26 CiaR target sites in S. pneumoniae, which include genes involved in cell wall polymer synthesis and modification, peptide pheromone and bacteriocin production, and the htrA-spo0J region .

How can recombinant CiaH protein be effectively expressed and purified?

The expression of recombinant CiaH protein presents challenges similar to other membrane-associated histidine kinases. Based on general principles of recombinant protein expression:

What methods are used to study CiaH mutation effects on bacterial phenotypes?

Researchers employ several approaches to study the effects of CiaH mutations:

  • Insertional inactivation: The ciaH gene can be inactivated using antibiotic resistance cassettes. For example, a terminatorless kanamycin resistance gene cassette was used to prevent polar effects on downstream genes when studying mutacin production in S. mutans .

  • PCR verification: After transformation and integration into the chromosome through homologous recombination, insertions are confirmed by PCR .

  • Reverse transcription-PCR: This technique verifies that insertions have no polar effect on the transcription of downstream genes .

  • Phenotypic assays: Specific assays are used to test the effects of mutations on relevant phenotypes:

    • Mutacin production assays (for S. mutans)

    • Antibiotic resistance testing (for S. pneumoniae)

    • Transformation efficiency assays to evaluate competence development

How might understanding CiaH function contribute to antimicrobial development?

Given CiaH's role in antibiotic resistance and bacterial cell wall integrity, targeting this protein or its downstream pathways represents a potential strategy for antimicrobial development. By understanding the molecular mechanisms through which CiaH mutations confer resistance to beta-lactams, researchers might identify vulnerabilities that could be exploited to enhance antibiotic efficacy or develop novel antimicrobials.

The attenuation of virulence observed in cia mutants also suggests that inhibiting CiaRH function might reduce bacterial pathogenicity . Further exploration of the CiaR regulon will likely reveal additional targets for therapeutic intervention.

What are the current challenges in CiaH protein research?

Several challenges persist in CiaH research:

  • Signal identification: The molecular nature of the signal sensed by the CiaH kinase remains unknown , complicating efforts to fully understand its activation mechanisms.

  • Protein expression difficulties: As with many membrane-associated proteins, recombinant expression of full-length, functional CiaH can be challenging and requires systematic optimization efforts .

  • Regulatory network complexity: The interconnection between the CiaRH system and other regulatory networks, particularly the ComCDE competence system, adds complexity to understanding its function .

  • Species-specific differences: The differences in CiaH function across bacterial species (e.g., S. pneumoniae vs. S. mutans) necessitate species-specific studies .

How can high-throughput approaches be applied to CiaH research?

High-throughput approaches offer promising avenues for advancing CiaH research:

  • Protein expression platforms: High-throughput recombinant protein expression platforms, such as those developed by Sino Biological using HEK293 cells, could facilitate the expression and functional verification of CiaH variants .

  • Mutagenesis screening: Systematic mutagenesis of CiaH combined with phenotypic screening could help identify critical residues for function and elucidate structure-function relationships.

  • Interactome analysis: High-throughput approaches to identify interaction partners of CiaH could reveal additional components of its regulatory network.

  • Transcriptomics: RNA-seq analysis comparing wild-type and ciaH mutant strains under various conditions could provide comprehensive insights into the CiaR regulon and its environmental responsiveness.

How does CiaH function differ between Streptococcus pneumoniae and Streptococcus mutans?

Despite the high sequence similarity between CiaH proteins in S. pneumoniae and S. mutans (55% identity and 72% similarity) , their functions appear to have species-specific aspects:

AspectS. pneumoniae CiaHS. mutans CiaH
Antibiotic resistanceMutations confer increased resistance to beta-lactams Less well characterized
Competence regulationMutations interfere with competence development Likely involved in competence, similar to S. pneumoniae
Bacteriocin productionNot specifically reportedInactivation abolishes mutacin I production but doesn't affect mutacin II or IV
VirulenceMutations lead to attenuation Not specifically reported
Cell wall integrityImportant for maintenance Not specifically reported

These differences highlight the importance of species-specific studies when investigating CiaH function.

What conservation exists in CiaRH systems across different bacterial genera?

Two-component signal-transducing systems like CiaRH are widely distributed across bacterial species, with varying degrees of conservation. The response regulator CiaR shows higher conservation (89% identity and 93% similarity between S. pneumoniae and S. mutans) than the sensor histidine kinase CiaH (55% identity and 72% similarity) , which is consistent with the general pattern observed in two-component systems where the kinase tends to be more variable due to its role in sensing different environmental signals.

The conservation of CiaRH across multiple streptococcal species suggests its fundamental importance in bacterial physiology, particularly in processes related to cell wall integrity, stress response, and genetic competence.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.