Recombinant Sensor protein CopS (copS)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to meet your requirements.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
copS; Sensor protein CopS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-487
Protein Length
full length protein
Species
Pseudomonas syringae pv. tomato
Target Names
copS
Target Protein Sequence
MKPGSLTLRLSLLFVVAVAAVLIIVGVAFNELSRHHFRALDAQALGEKLEAITQIAKESG
ANPELLKARWHTLLGAHPDLSAVFLKTDGTPFFAEPPQSAVPSLAQATQRDGVWEWEKEG
RMFRALTASVSLPTASPPLTAWLVLDVTTHMHFFAMLERWFWGVLLASTVLSAALGWLVA
KNGLRPVARVTQTAASMSAGSLKERIPLEPVPDELRALITAFNSMLGRLDDSFMRLSNFS
ADIAHELRTPISNLRTHTEVILAKKRAPEVYEENLSSNLEELNRLSGIIDGMLFLAKSDN
GLIVPEAVELDLRTVISKLFGYYEFLAEDKGIQLQASGNASIFADSVMIDRVVSNLLSNA
LRYTSSGETIKVSIHDHGGRVELRLENPGPEIVPQHLDRIFDRFYRVDPARREGRECGAG
ASDCPVLDASAWRHYLVYIPRGPNDLHPHLHAIACPTNLTCRPDSLGTAKPGHTRLGEHE
TGCHCAG
Uniprot No.
Target Background
Function
Recombinant Sensor protein CopS (copS) is a member of the two-component regulatory system CopS/CopR. It is involved in activating the copper resistance gene operon copABCD by specifically recognizing and transducing copper signals. This process leads to the phosphorylation of CopR in the cytoplasm. The CopS/CopR system may also regulate chromosomally encoded genes and participate in basic copper metabolism.
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
