Recombinant Sensor protein CseC (cseC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cseC; SAV_4703; Sensor protein CseC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-487
Protein Length
full length protein
Species
Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Target Names
cseC
Target Protein Sequence
MRGNLRRPGPAGTAGPGRTGIRTSADGGRARPRTGAGTGVRAGVRSGVVGVGAGIRTGVR WKISAAIALVGALVALALSLVVHNAARVSMLDNARDLADERIQVAERMYEAGRAQSFGVK LDDPAIPRDLMMKVTQGRRATYVADGPHGVPDIWAAVPLKDGRVLSLHTRFTDRSADIMK DLDQALIIGSIAVVFGGSALGVLIGGQLSRRLRKAAAAANQVAQGERDVRVRDAIGGVVR DETDDLARAVDAMADALQQRIEAERRVTADIAHELRTPVTGLLTAAELLPPGRPTELVRD RAQAMRTLVEDVLEVARLDGASERAELQDIMLGEFVSRRVAAKDADIEVRVVHESEVTTD PRRLERVLFNLLANAARHGKPPIEVSVEGRVIRVRDHGPGFPEELLADGPRRFRTGSTDR AGHGHGLGLTIAAGQARVLGARLTFRNVRPAGAPGDVPAEGAVAVLWLPEHAPTNTGSFP MLPLSGG
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of CseC in bacterial cell signaling?

CseC functions as a transmembrane sensor histidine protein kinase that works alongside its cognate response regulator CseB in a two-component signal transduction system. This system modulates the activity of the sigE promoter in response to signals from the cell envelope . Specifically, CseC detects cell envelope stress signals, undergoes autophosphorylation, and then transfers the phosphoryl group to CseB, which activates transcription of sigE. The sigE gene encodes the extracytoplasmic function (ECF) sigma factor σE, which directs RNA polymerase to transcribe genes involved in cell wall homeostasis.

The CseC/CseB system appears to be dedicated solely to regulating sigE expression, as evidenced by the identical phenotypes observed in sigE and cseB null mutants . This represents an unusual case where a two-component system is exclusively committed to regulating an RNA polymerase sigma factor.

How is the CseC-CseB signal transduction pathway organized?

The sigE operon encodes a complex signal transduction pathway consisting of four key components: σE (an ECF sigma factor), CseA (a lipoprotein), CseB (a response regulator), and CseC (a sensor kinase) . This constitutes the σE-CseABC signal transduction pathway in Streptomyces coelicolor. The pathway operates as follows:

  • CseC detects cell envelope stress signals and autophosphorylates

  • The phosphoryl group is transferred to the response regulator CseB

  • Phosphorylated CseB activates transcription from the sigE promoter

  • Resulting σE protein associates with RNA polymerase to direct transcription of genes involved in cell wall homeostasis

  • CseA, a lipoprotein, acts as a negative regulator of sigE expression, potentially by blocking signal sensing by CseC

This integrated pathway enables bacteria to respond appropriately to cell envelope damage and maintain cell wall integrity.

What signals are detected by CseC?

CseC appears to respond specifically to cell envelope damage and stress. Experimental evidence shows that expression of sigE (which is regulated by the CseB/CseC system) can be induced by various cell wall-specific compounds, including:

  • Antibiotics that target cell wall synthesis, such as vancomycin and bacitracin

  • Muramidases like lysozyme that directly degrade peptidoglycan

  • Potentially other agents that compromise cell envelope integrity

The specific molecular signals directly detected by CseC have not been fully characterized, but they likely include peptidoglycan fragments or other cell wall components released during damage. The essentiality of CseC suggests its critical role in continually monitoring cell envelope integrity under various conditions .

Why is CseC considered essential in Streptomyces coelicolor?

Unlike many two-component system proteins, CseC appears to be essential in Streptomyces coelicolor. While null mutations have been successfully created in sigE, cseA, and cseB genes, all attempts to disrupt cseC have been unsuccessful . This essentiality suggests several important aspects of CseC function:

  • CseB can likely be activated through cross-talk from other sensor kinases in the absence of CseC

  • Overexpression of σE resulting from unregulated CseB activation may be lethal to the cell

  • CseC may have additional critical functions beyond regulating sigE expression

  • The continuous monitoring of cell wall integrity by CseC may be indispensable for cell survival

This essentiality presents significant challenges for researching CseC function and necessitates alternative approaches like conditional expression systems or dominant negative variants.

What expression systems are optimal for recombinant CseC production?

Due to the membrane-associated nature of CseC, specialized expression systems are necessary for efficient recombinant production. The following table summarizes optimal expression systems for CseC production:

Expression SystemAdvantagesConsiderations
E. coli C41(DE3)/C43(DE3)Specialized for toxic membrane proteinsMay require codon optimization for high-GC Streptomyces genes
E. coli with pBAD vectorTight regulation; tunable expressionRequires L-arabinose inducer
Streptomyces lividansNative-like membrane environmentSlower growth; more complex transformation
Cell-free expressionAvoids toxicity; direct incorporation into nanodiscsHigher cost; typically lower yields

For CseC, which comes from the high-GC Gram-positive Streptomyces, codon optimization for E. coli expression is recommended . Expression at lower temperatures (16-20°C) promotes proper folding, and inclusion of fusion tags like MBP (maltose-binding protein) can enhance solubility.

In the case of the SPA-Cys protein (a related recombinant protein with special cysteine residues for oriented immobilization), researchers found that the recombinant version showed significantly better immobilization efficiency and binding capacity compared to the native protein . This suggests that careful recombinant design can substantially improve protein functionality.

What purification strategies are effective for membrane proteins like CseC?

Purifying recombinant CseC requires specialized approaches due to its membrane-associated nature. A methodological approach includes:

  • Membrane extraction:

    • Isolation of bacterial membranes through differential centrifugation

    • Solubilization with mild detergents (DDM, LMNG, or digitonin)

  • Affinity purification:

    • Use of His-tag or other affinity tags (Strep-tag II, FLAG-tag) for initial capture

    • Inclusion of appropriate detergent in all buffers to maintain protein solubility

  • Size exclusion chromatography:

    • Removal of aggregates and purification of monodisperse protein-detergent complexes

    • Analysis of oligomeric state (sensor kinases often function as dimers)

  • Optional reconstitution:

    • Transfer of purified protein into nanodiscs, liposomes, or amphipols for functional studies

    • Selection of lipid composition similar to native Streptomyces membranes

The purification protocol should be optimized for each specific construct, with careful attention to maintaining the native conformation of the protein. For orientation-dependent applications like biosensor development, specialized approaches like those used with SPA-Cys may significantly improve functionality compared to conventional methods .

How can the activity of recombinant CseC be verified in vitro?

Verifying the activity of recombinant CseC requires testing its fundamental properties as a sensor histidine kinase. Several complementary approaches include:

  • Autophosphorylation assay:

    • Incubation of purified CseC with ATP and Mg²⁺

    • Detection of phosphorylated CseC via Phos-tag gel electrophoresis

    • Control: inclusion of a catalytically inactive mutant (H→A substitution at the conserved histidine)

  • Phosphotransfer to CseB:

    • Addition of purified CseB to autophosphorylated CseC

    • Monitoring of phosphoryl transfer from CseC to CseB

    • Detection via SDS-PAGE with Phos-tag acrylamide or mass spectrometry

  • Response to cell wall stress signals:

    • Testing the effect of potential activating molecules (cell wall components, antibiotics)

    • Monitoring changes in autophosphorylation or phosphotransfer rates

    • Comparison with known membrane stress-responsive kinases

Surface plasmon resonance (SPR) spectroscopy can also be useful for detecting protein-protein interactions, such as between CseC and CseB or potential accessory proteins. This approach has been successfully applied to study interactions between recombinant proteins like the SPA-Cys system described in the literature .

What structural characterization methods work best for membrane proteins like CseC?

Structural characterization of CseC, a membrane-associated sensor histidine kinase, requires specialized techniques suitable for membrane proteins:

For membrane proteins like CseC, a combination of these methods is typically necessary to build a comprehensive structural understanding. Initial characterization with CD spectroscopy to confirm proper folding, followed by more detailed structural analysis using SAXS and HDX-MS, provides a good starting point before attempting more resource-intensive techniques like cryo-EM.

How can site-directed mutagenesis be used to study CseC signal detection mechanisms?

Site-directed mutagenesis provides a powerful approach to dissect the molecular mechanisms of CseC signal detection:

  • Targeting the putative sensor domain:

    • Identification of conserved residues in extracellular/periplasmic regions through sequence alignment

    • Creation of alanine substitutions of charged or hydrophobic residues potentially involved in ligand binding

    • Generation of chimeric constructs by swapping sensor domains with related kinases

  • Targeting the transmembrane domains:

    • Mutation of residues at the membrane interface that might be involved in signal transduction

    • Scanning mutagenesis along transmembrane helices to identify critical residues

    • Introduction of proline residues to disrupt helical structure and test effects on signaling

  • Targeting the kinase domain:

    • Mutation of the conserved histidine residue that becomes phosphorylated (H→A)

    • Modification of residues involved in ATP binding

    • Introduction of mutations in the dimerization and histidine phosphotransfer (DHp) domain

Each mutant should be tested for autophosphorylation activity, phosphotransfer to CseB, response to cell wall stress signals, and ability to complement a conditional cseC mutant phenotype. This approach can reveal critical residues involved in signal detection and transduction.

What approaches can determine if CseC functions similarly to other two-component system sensors?

CseC belongs to the broader family of two-component system sensor histidine kinases but has several unique features that warrant comparative investigation:

  • Bioinformatic analysis:

    • Phylogenetic comparison with other sensor kinases

    • Identification of conserved and divergent domains

    • Analysis of gene neighborhood and operon structure across species

  • Domain analysis:

    • Comparison of sensor domains with well-characterized systems like VanS

    • Analysis of kinase domain conservation relative to canonical examples

    • Investigation of unique structural features not found in other systems

  • Chimeric protein studies:

    • Creation of fusion proteins with sensor/kinase domains from different systems

    • Testing functionality of chimeric proteins

    • Identification of domains responsible for signal specificity

  • Comparison to related systems:

    • Comparison with other ECF sigma factor regulatory systems

    • Examination of similarities to other cell wall stress-sensing kinases

    • Analysis of cross-talk potential with other two-component systems

CseC appears unusual in being solely dedicated to regulating an RNA polymerase sigma factor, making it distinct from most other two-component systems . Additionally, its apparent essentiality and its integration with the lipoprotein CseA as a negative regulator suggest a unique signaling architecture worthy of detailed comparative analysis.

How can phosphotransfer activity between CseC and CseB be measured in vitro?

Phosphotransfer between CseC and CseB can be measured using several complementary biochemical approaches:

  • Phos-tag SDS-PAGE:

    • Performance of phosphotransfer reactions with non-radioactive ATP

    • Separation of phosphorylated and non-phosphorylated proteins using Phos-tag acrylamide gels

    • Visualization with Coomassie staining or western blotting

    • Quantification of the phosphorylated fraction of each protein

  • Mass spectrometry-based approaches:

    • Performance of phosphotransfer reactions and quenching at different timepoints

    • Digestion of proteins and analysis by LC-MS/MS

    • Monitoring of phosphorylated peptides containing the conserved histidine (CseC) and aspartate (CseB)

    • Determination of rates of phosphorylation and dephosphorylation

  • FRET-based real-time assay:

    • Creation of fluorescently labeled CseC and CseB (e.g., with CFP and YFP)

    • Monitoring of FRET changes during phosphotransfer reactions in real-time

    • Calculation of reaction kinetics from FRET signal changes

These assays can determine critical parameters including the rate of CseC autophosphorylation, the rate of phosphotransfer from CseC to CseB, the stability of phosphorylated CseB, and the effects of potential activating signals on these rates.

How does CseA interact with the CseB/CseC system?

CseA, a lipoprotein encoded within the sigE operon, acts as a negative regulator of sigE expression . Understanding its interaction with the CseB/CseC system requires specialized approaches:

  • Localization studies:

    • Confirmation of CseA membrane localization through fractionation

    • Determination of orientation using protease accessibility experiments

    • Fluorescent tagging to visualize localization relative to CseC

  • Interaction studies:

    • Co-immunoprecipitation to detect physical interaction with CseC

    • Surface plasmon resonance to measure binding kinetics

    • Crosslinking experiments to capture transient interactions

  • Functional assays:

    • Measurement of CseC autophosphorylation ± purified CseA

    • Determination of CseA effects on phosphotransfer to CseB

    • Testing of CseA fragments to identify interaction domains

Since CseA is extracellular and likely blocks signal sensing by CseC , it represents an important regulatory component of this system. The mechanism might be similar to how HbpS interacts with SenS in another Streptomyces two-component system , where an accessory protein modulates the activity of the sensor kinase. Understanding this interaction could provide insights into novel regulatory mechanisms for two-component systems.

How can reporter gene assays be designed to measure CseC-dependent signaling?

Reporter gene assays provide powerful tools to measure CseC-dependent signaling in vivo:

  • Reporter system design:

    • Cloning of the sigE promoter region upstream of reporter genes such as:

      • luxAB (luciferase) for quantitative luminescence detection

      • gfp or mCherry for fluorescence microscopy

      • lacZ for colorimetric β-galactosidase assays

    • Inclusion of appropriate transcriptional terminators

  • Genetic backgrounds for testing:

    • Wild-type strain (positive control)

    • ΔcseB strain (negative control)

    • Strains with point mutations in the CseC sensor domain

    • Conditional cseC expression strains (if available)

  • Experimental conditions:

    • Testing of various cell wall stressors (vancomycin, lysozyme, bacitracin)

    • Variation of concentrations to establish dose-response relationships

    • Inclusion of time-course measurements to capture signaling dynamics

    • Testing of conditions with varying magnesium concentrations, as Mg²⁺ suppresses the CseB/SigE phenotype

  • Controls and normalizations:

    • Inclusion of a constitutive promoter driving a different reporter for normalization

    • Measurement of bacterial growth (OD600) to account for growth effects

    • Inclusion of untreated controls to determine basal activity

Such reporter systems enable quantitative assessment of CseC-dependent signaling under various conditions and genetic backgrounds, providing insights into activation mechanisms and signal specificity.

What challenges exist in studying essential genes like cseC?

Studying essential genes like cseC presents significant challenges, as conventional deletion strategies are not viable . Alternative approaches include:

  • Conditional expression systems:

    • Use of tightly regulated inducible promoters

    • Creation of depletion strains where the native gene is complemented with an inducible copy

    • Employment of degron tags for controlled protein degradation

  • Dominant negative approaches:

    • Expression of mutated versions that interfere with wild-type function

    • Creation of truncated variants lacking kinase activity but retaining sensor function

    • Overexpression of isolated domains that may disrupt normal signaling

  • Bypass strategies:

    • Manipulation of downstream components (CseB, σE)

    • Creation of constitutively active CseB variants

    • Expression of σE from heterologous promoters to study CseC-independent effects

  • Chemical genetics:

    • Use of small molecules to modulate CseC activity

    • Application of specific cell wall stressors to activate the pathway

    • Development of CseC-specific inhibitors

These approaches can provide valuable insights into CseC function despite its essentiality, which likely stems from the fact that CseB can be activated via cross-talk in the absence of CseC, potentially leading to toxic overexpression of σE .

How can computational modeling inform experimental approaches for CseC research?

Computational modeling provides valuable insights to guide experimental studies of CseC function:

  • Homology modeling and structural prediction:

    • Generation of 3D models based on related sensor kinases

    • Identification of potential ligand-binding pockets

    • Prediction of conformational changes associated with activation

    • Guidance for selecting residues for mutagenesis studies

  • Molecular dynamics simulations:

    • Modeling of CseC behavior in a lipid bilayer environment

    • Simulation of interactions with cell wall components

    • Examination of conformational changes during signal transduction

    • Prediction of allosteric pathways connecting sensor and kinase domains

  • Systems biology modeling:

    • Creation of mathematical models of the complete CseC-CseB-σE signaling pathway

    • Simulation of pathway dynamics under different conditions

    • Prediction of system behavior in response to perturbations

Computational approaches like these can inform experimental design by prioritizing specific residues for site-directed mutagenesis, suggesting potential ligands or activating signals, predicting phenotypic effects of specific mutations, and developing hypotheses about signal transduction mechanisms.

What controls are essential when studying recombinant CseC function?

When designing experiments to study recombinant CseC function, appropriate controls are crucial:

  • Protein quality controls:

    • Size exclusion chromatography to verify monodispersity

    • Circular dichroism to confirm secondary structure content

    • Thermal shift assay to assess protein stability

    • Western blotting to confirm full-length protein

  • Negative controls for activity assays:

    • Catalytically inactive mutant (H→A substitution at the conserved histidine)

    • Heat-denatured protein

    • Reaction mixtures lacking ATP or Mg²⁺

    • Buffer-only controls

  • Positive controls:

    • Well-characterized related sensor kinase (if available)

    • CseC from the native organism (Streptomyces coelicolor)

    • Known activating conditions (if established)

  • Specificity controls:

    • Testing of phosphotransfer to non-cognate response regulators

    • Comparison of activation by specific vs. non-specific membrane perturbations

    • Inclusion of structurally similar but functionally distinct compounds in ligand screening

These controls ensure that experimental observations can be confidently attributed to specific CseC functions rather than artifacts or non-specific effects.

How can issues with recombinant CseC insolubility or aggregation be addressed?

Membrane proteins like CseC often present challenges with insolubility or aggregation. A methodological troubleshooting approach includes:

  • Expression optimization:

    • Reduction of expression temperature (16-20°C) to slow folding

    • Use of weaker promoters or lower inducer concentrations

    • Testing of different E. coli strains specialized for membrane proteins

    • Consideration of expression in native or closely related Streptomyces hosts

  • Fusion tags and constructs:

    • Testing of multiple solubility-enhancing fusion partners (MBP, SUMO)

    • Creation of truncation constructs removing flexible regions

    • Expression of cytoplasmic domain separately from transmembrane domains

  • Detergent screening:

    • Systematic testing of different detergent classes:

      • Maltoside detergents (DDM, DM)

      • Glucoside detergents (OG, NG)

      • Neopentyl glycol detergents (LMNG)

    • Optimization of detergent concentration

  • Buffer optimization:

    • Screening of buffer compositions (pH, salt concentration)

    • Addition of stabilizing agents (glycerol, specific lipids)

    • Testing of additives known to enhance membrane protein stability

Similar optimization strategies proved highly successful with the recombinant SPA-Cys protein, which demonstrated almost 4-fold advantage in the number of immobilized molecules compared to its non-recombinant counterpart .

How can the complex relationship between CseC, CseB, and σE be experimentally validated?

Validating the complex relationship between CseC, CseB, and σE requires multiple lines of experimental evidence:

  • Genetic approaches:

    • Creation of strains with mutations in individual components

    • Comparison of phenotypes across mutants

    • Epistasis analysis with double mutants

    • Complementation studies with wild-type and mutant alleles

  • Biochemical validation:

    • Demonstration of direct phosphotransfer from CseC to CseB

    • Showing that phosphorylated CseB binds the sigE promoter

    • Proof that σE directs transcription of cell wall homeostasis genes

  • Transcriptomic analysis:

    • Comparison of gene expression profiles in wild-type vs. mutant strains

    • Identification of genes regulated by σE

    • Demonstration that these genes respond to cell wall stress in a CseC/CseB-dependent manner

  • Reporter gene studies:

    • Use of sigE promoter-reporter fusions to demonstrate CseB-dependent activation

    • Tracking of σE-dependent gene expression in response to cell wall stress

    • Showing dependence of this pathway on functional CseC

This multi-faceted approach can validate the model in which the CseC/CseB two-component system modulates activity of the sigE promoter in response to signals from the cell envelope , and demonstrate that the resulting σE protein directs transcription of genes involved in cell wall homeostasis.

What approaches can determine the specific signals detected by CseC?

Identifying the specific molecular signals detected by CseC requires a multi-faceted approach:

  • Candidate ligand screening:

    • Testing of purified cell wall components (peptidoglycan fragments, teichoic acids)

    • Screening of antibiotics known to disrupt cell wall integrity (vancomycin, bacitracin)

    • Examination of metabolites produced during cell envelope stress

  • Activity-based approaches:

    • Monitoring of CseC autophosphorylation in response to candidate molecules

    • Measurement of changes in intrinsic fluorescence upon ligand binding

    • Use of thermal shift assays to detect stabilizing ligands

  • Genetic approaches:

    • Creation of reporter strains with sigE promoter fused to reporter genes

    • Performance of transposon mutagenesis to identify genes affecting reporter activity

    • Screening for mutations that alter response to cell wall stress

  • Structural approaches:

    • Attempt at co-crystallization with putative ligands

    • Use of HDX-MS to identify regions with altered solvent accessibility upon ligand binding

These approaches are particularly important given that CseC appears to respond to a wide range of cell wall-specific compounds , suggesting it might recognize common structural features associated with cell wall damage rather than specific molecular entities.

How can experimental designs address the influence of CseA on CseC function?

CseA acts as a negative regulator of sigE expression, likely by blocking signal sensing by CseC . Experimental designs to address this interaction include:

  • Protein-protein interaction studies:

    • Co-immunoprecipitation of CseA and CseC

    • Surface plasmon resonance to measure binding kinetics and affinity

    • FRET assays to detect interactions in vivo

    • Bacterial two-hybrid assays to map interaction domains

  • Functional assays:

    • Measurement of CseC autophosphorylation in the presence/absence of CseA

    • Testing of CseC response to activating signals ± CseA

    • Determination of whether CseA affects CseC-CseB phosphotransfer

  • Structural studies:

    • Mapping of interaction surfaces using HDX-MS or cross-linking

    • Crystallization of CseA-CseC complexes (or relevant domains)

    • Computational docking to predict interaction interfaces

  • Genetic approaches:

    • Construction of cseA mutants with altered CseC interaction

    • Testing of truncated CseA variants to map minimal inhibitory domains

    • Creation of CseC variants resistant to CseA inhibition

This experimental framework can elucidate how CseA, as an extracellular lipoprotein, modulates CseC activity and thereby regulates the entire σE-CseABC signal transduction pathway.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.