Recombinant Sensor protein dltS (dltS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and arranged in advance, incurring additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If a particular tag is required, please inform us, and we will prioritize its development.
Synonyms
dltS; SAG1791; Sensor protein DltS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-395
Protein Length
full length protein
Species
Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Target Names
dltS
Target Protein Sequence
MFSDLRKKFVFLTMSILIVVVLFLFAVSNRYNQYWDEYDAYRIVKLVAKNDYLGIPGDEP IALVTIDNQKMVKIQSNNTDLTNDVIEKSSLKLLEQGKKSRKWKSFIYSIKEYKDKTYTI AIMDLASYEVPYARRFLILVFTIFGFCLLAAVSLYLSRFIVGPVETEMTREKQFVSDASH ELKTPIAAIRANVQVLEQQIPGNRYLDHVVSETKRMEFLIEDLLNLSRLDEKRSKVNFKK LNLSVLCQEVLLTYESLAYEEEKCLNDTIEDDVWIVGEESQIKQILIILLDNAIRHSLSK SAIQFSLKQARRKAILTISNPSAIYSKEVMDNLFERFYQAKDDHADSLSFGLGLSIAKAI VERHKGRIRAYQEKDQLRLEVQLPIDGFWTNTMIN
Uniprot No.

Target Background

Function
Member of the two-component regulatory system DltS/DltR. It regulates the expression of the *dlt* operon and likely phosphorylates DltR.
Database Links

KEGG: sag:SAG1791

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is sensor protein DltS and what is its role in bacterial physiology?

Sensor protein DltS is a membrane-bound histidine kinase that functions as part of a two-component signal transduction system (TCS) in bacteria, particularly in Gram-positive species like Streptococcus agalactiae. DltS is encoded by the dltS gene within the dlt operon, which typically comprises five genes: dltX, dltA, dltB, dltC, and dltD . These genes collectively regulate the D-alanylation of teichoic acids (TAs) in the bacterial cell wall.

The primary function of DltS is to sense environmental conditions and transmit signals through phosphorylation cascades. When activated, DltS autophosphorylates at a conserved histidine residue and subsequently transfers this phosphoryl group to its cognate response regulator. This phosphorylation event typically leads to changes in gene expression that enable bacteria to adapt to environmental stresses .

Research has demonstrated that DltS plays a crucial role in bacterial resistance to antimicrobial peptides, autolysis control, and modulation of host immune responses . The D-alanylation process mediated by the Dlt system introduces positive charges to otherwise negatively charged teichoic acids, affecting the bacterial cell surface charge and consequently bacterial interactions with host immune factors.

What are the optimal conditions for expressing recombinant DltS protein?

Recombinant DltS protein is typically expressed in E. coli expression systems, which provide high yield and relatively straightforward purification . Based on established protocols for histidine kinases and sensor proteins, the following conditions are recommended:

Expression System:

  • Host: E. coli BL21(DE3) or similar strains optimized for protein expression

  • Vector: pET-based expression vectors with T7 promoter

  • Fusion tags: N-terminal His6-tag for affinity purification

Culture Conditions:

  • Medium: LB or 2xYT supplemented with appropriate antibiotics

  • Induction: 0.1-0.5 mM IPTG when OD600 reaches 0.6-0.8

  • Post-induction temperature: 16-18°C for 16-20 hours (lower temperatures minimize inclusion body formation)

  • Aeration: Vigorous shaking (200-250 rpm) to maintain adequate oxygenation

Critical Considerations:

  • As DltS is a membrane-associated protein, addition of membrane-mimicking detergents (0.1-1% Triton X-100, DDM, or CHAPS) during lysis can improve solubility

  • Co-expression with molecular chaperones (GroEL/GroES) may enhance proper folding

  • Addition of ATP (1-5 mM) and magnesium (5-10 mM MgCl2) to lysis buffers can stabilize the protein's conformation

Researchers should optimize these conditions through small-scale expression trials before scaling up for purification.

What is the recommended purification protocol for His-tagged DltS protein?

The following step-by-step purification protocol is recommended for His-tagged DltS protein based on established methods for histidine kinases:

1. Cell Lysis:

  • Resuspend cell pellet in lysis buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 10% glycerol, 5 mM β-mercaptoethanol, 1 mM PMSF, protease inhibitor cocktail)

  • Lyse cells by sonication or French press

  • Clarify lysate by centrifugation (18,000 × g, 30 min, 4°C)

2. Affinity Chromatography:

  • Apply clarified lysate to Ni-NTA resin pre-equilibrated with lysis buffer

  • Wash with 10-15 column volumes of wash buffer (lysis buffer with 20-30 mM imidazole)

  • Elute protein with elution buffer (lysis buffer with 250-300 mM imidazole)

3. Size Exclusion Chromatography:

  • Pool and concentrate affinity-purified fractions

  • Apply to a Superdex 200 column equilibrated with storage buffer (50 mM Tris-HCl pH 7.5, 150 mM NaCl, 5 mM MgCl2, 10% glycerol, 1 mM DTT)

  • Collect fractions corresponding to properly folded DltS (typically dimeric form)

4. Storage:

  • Concentrate purified protein to 1-5 mg/mL

  • Add glycerol to 50% final concentration

  • Flash-freeze in liquid nitrogen and store at -80°C in small aliquots to avoid freeze-thaw cycles

Purity Assessment:

  • Analyze by SDS-PAGE (≥90% purity is recommended for functional studies)

  • Verify identity by Western blot using anti-His antibodies or mass spectrometry

Reconstitution Procedure:

  • Prior to experiments, centrifuge thawed protein briefly to remove any aggregates

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • For long-term storage at -20°C/-80°C, add glycerol to 5-50% final concentration

How can the autophosphorylation activity of DltS be measured accurately?

The autophosphorylation activity of DltS can be measured using several complementary techniques:

Radiometric Assay:

  • Prepare reaction mixture containing purified DltS (1-5 μM) in reaction buffer (50 mM Tris-HCl pH 7.5, 50 mM KCl, 10 mM MgCl2)

  • Initiate reaction by adding [γ-32P]ATP (final concentration 10-100 μM)

  • Incubate at 25-37°C for various time points (0-30 min)

  • Stop reaction by adding SDS-PAGE loading buffer with EDTA (10 mM)

  • Analyze by SDS-PAGE followed by autoradiography or phosphorimaging

  • Quantify radiolabeled bands to determine phosphorylation levels

Fluorescence-Based Real-Time Assay:
This newer approach uses fluorescent protein probes fused to the response regulator to monitor phosphorylation-induced dimerization in real-time, even in live bacteria. The method is based on oligomerization-dependent depolarization of excitation light by fused mNeonGreen fluorescent protein probes .

  • Create fusion constructs of DltS and its cognate response regulator with appropriate fluorescent proteins

  • Express proteins in bacterial cells or reconstitute in vitro

  • Monitor changes in fluorescence polarization or FRET upon addition of stimuli

  • This allows for detection of phosphorylation events within seconds of stimulus addition

Phos-tag SDS-PAGE:

  • Prepare reaction as above but with non-radioactive ATP

  • Resolve samples on SDS-PAGE gels containing Phos-tag acrylamide and MnCl2

  • Phosphorylated forms migrate more slowly, allowing separation from non-phosphorylated forms

  • Visualize with Coomassie staining or Western blotting

For all methods, include appropriate controls:

  • Negative control: DltS with mutation in the conserved histidine residue

  • Positive control: Well-characterized histidine kinase with known activity

  • ATP-free control: To establish baseline

What techniques are most effective for studying DltS-substrate interactions?

Several biophysical and biochemical techniques are effective for studying DltS-substrate interactions:

Isothermal Titration Calorimetry (ITC):

  • Provides direct measurement of binding thermodynamics (Kd, ΔH, ΔS)

  • Requires 0.5-2 mg of purified DltS and potential ligands

  • Allows determination of binding stoichiometry

  • No labeling required

Surface Plasmon Resonance (SPR):

  • Measures real-time binding kinetics (kon, koff)

  • Requires immobilization of DltS on sensor chip

  • Can detect interactions with small molecules and proteins

  • Consumes less protein than ITC

Fluorescence-Based Techniques:

  • Intrinsic tryptophan fluorescence: Monitor changes in emission spectra upon ligand binding

  • Fluorescence anisotropy: Label potential ligands with fluorophores and measure changes in polarization upon binding

  • FRET: Engineer fluorescent protein pairs to detect conformational changes

Deep-Level Transient Spectroscopy (DLTS):
While typically used for semiconductor studies , modified spectroscopic approaches can help characterize conformational transitions in sensor proteins like DltS:

  • Measure capacitance transients at different temperatures

  • Analyze emission rates as a function of temperature using Arrhenius plots

  • Extract activation energies for conformational changes

X-ray Crystallography and NMR:
For detailed structural analysis of DltS-ligand complexes:

  • X-ray crystallography: Provides atomic-resolution structures of protein-ligand complexes, though crystallizing membrane proteins is challenging

  • NMR spectroscopy: Particularly solid-state NMR can provide insights into conformational changes upon ligand binding in membrane-embedded proteins

When designing interaction studies, researchers should consider:

  • The membrane-associated nature of DltS may require detergents or lipid nanodiscs for proper folding

  • Potential cofactors (e.g., ATP, Mg2+) that might be required for physiologically relevant interactions

  • The oligomeric state of DltS (likely dimeric) for accurate interpretation of binding data

How does DltS function within the context of bacterial two-component signaling systems?

DltS functions as a sensor histidine kinase (HK) within a typical bacterial two-component signaling system (TCS). These systems enable bacteria to sense and respond to environmental changes through a phosphorelay mechanism .

Signaling Mechanism:

  • Signal perception: DltS likely senses specific environmental stimuli via its PAS domain

  • Autophosphorylation: Upon stimulation, DltS undergoes ATP-dependent autophosphorylation at a conserved histidine residue

  • Phosphotransfer: The phosphoryl group is transferred to an aspartate residue on the cognate response regulator

  • Response: The phosphorylated response regulator typically functions as a transcription factor, activating or repressing target genes

  • Ligand binding to the sensor domain

  • Conformational changes transmitted through the transmembrane helices

  • Helical bending at the DHp domain (often facilitated by a conserved proline adjacent to the phosphoryl acceptor histidine)

  • Repositioning of the CA domain to enable autophosphorylation

Recent research using solid-state NMR and crystallography has revealed that ligand binding can trigger a piston-like pulling of transmembrane helices, leading to quaternary structure rearrangements in the cytosolic domains. This can induce a transition from anti-parallel to parallel dimer conformations in the cytosolic PAS domain .

Regulation Mechanisms:
DltS activity may be regulated through:

  • Direct ligand binding

  • Interaction with accessory proteins

  • Bifunctional kinase/phosphatase activity (common in many HKs)

  • Formation of higher-order oligomeric structures

Understanding these mechanisms is essential for developing strategies to modulate bacterial signaling pathways for therapeutic purposes.

What is the relationship between DltS activity and bacterial antimicrobial resistance?

The relationship between DltS activity and bacterial antimicrobial resistance is multifaceted and involves several interconnected mechanisms:

D-alanylation of Teichoic Acids:
DltS, as part of the dlt operon, regulates the D-alanylation of teichoic acids (TAs) in the bacterial cell wall. This modification has significant implications for antimicrobial resistance :

  • The addition of D-alanine introduces positive charges to otherwise negatively charged TAs

  • This charge modification reduces the affinity of cationic antimicrobial peptides (CAMPs) for the bacterial surface

  • Consequently, bacteria with active dlt systems show increased resistance to CAMPs, including host-derived defensins and certain antibiotics

Experimental Evidence:
Research has demonstrated that mutations in the dlt operon (including dltS) affect bacterial resistance profiles:

  • Mutation of dltD in Lactococcus lactis results in:

    • Increased susceptibility to UV radiation

    • Altered cell wall properties

    • Changes in plasmid transfer rates during conjugation

    • Modified electrocompetence characteristics (cells can be made electrocompetent without glycine addition)

  • Drosophila infection models have shown that D-alanylation of TAs:

    • Impedes the sensing of peptidoglycan from Bacillus thuringiensis

    • Hampers activation of the immune deficiency (IMD) pathway

    • Is essential for the resistance of Lactobacillus plantarum to intestinal lysozyme

Cell Wall Integrity and Autolysis Regulation:
DltS activity influences autolysis processes in bacteria:

  • In Lactococcus lactis, the dlt operon affects AcmA-dependent autolysis

  • A dltD mutant exhibits increased autolysis compared to wild type

  • This effect is related to changes in how autolysins interact with teichoic acids in the cell wall

Implications for Antibiotic Development:
The DltS signaling pathway represents a potential target for novel antimicrobial strategies:

  • Inhibitors of DltS could potentially increase bacterial susceptibility to host immune defenses

  • Combination therapies targeting DltS along with conventional antibiotics might enhance treatment efficacy

  • Understanding DltS-mediated resistance mechanisms can inform the design of antibiotics that remain effective against resistant strains

Researchers seeking to exploit this relationship should consider assessing changes in antimicrobial susceptibility profiles when studying DltS function and regulation.

What approaches can be used to study DltS protein interactions in the context of the bacterial membrane?

Studying membrane-associated proteins like DltS presents unique challenges due to their hydrophobic nature and requirement for a lipid environment. The following approaches are specifically tailored for investigating DltS protein interactions within membrane contexts:

1. Membrane Reconstitution Systems:

SystemAdvantagesLimitationsBest Applications
ProteoliposomesNatural lipid environment, Control over lipid compositionLimited internal volume, Potential vesicle fusionBinding studies, Transport assays
NanodiscsDefined size, Access to both protein faces, Homogeneous preparationComplex preparation, Limited sizeStructural studies, Single-molecule experiments
BicellesCompatible with NMR, Mimics bilayer propertiesSize limitations, Specific lipid requirementsSolution NMR studies
GUVs (Giant Unilamellar Vesicles)Large size enables microscopy, Cell-like dimensionsFragile, Challenging protein incorporationFluorescence microscopy, Micromanipulation studies

2. Fluorescence-Based Techniques for Membrane Proteins:

  • FRET pairs positioned on DltS and potential interaction partners can detect proximity changes

  • Fluorescence correlation spectroscopy (FCS) for measuring diffusion coefficients and complex formation

  • Single-molecule tracking to observe dynamic interactions in reconstituted membranes

  • Fluorescence recovery after photobleaching (FRAP) to assess protein mobility and clustering

3. Advanced Microscopy Approaches:

  • Super-resolution microscopy (PALM/STORM) to visualize nanoscale organization of DltS and interaction partners

  • Cryo-electron microscopy for structural determination of membrane protein complexes

  • Atomic force microscopy (AFM) to observe topographical changes upon ligand binding or protein-protein interactions

4. Crosslinking Strategies for Capturing Transient Interactions:

  • Photo-crosslinking with unnatural amino acids incorporated at specific positions in DltS

  • Chemical crosslinking followed by mass spectrometry (XL-MS) to map interaction interfaces

  • Proximity labeling approaches (BioID, APEX) to identify proteins in the vicinity of DltS in vivo

5. Real-Time Detection of Response Regulator Phosphorylation:
A novel optical method has been developed that allows for direct observation of TCS signaling dynamics via phosphorylation-induced response regulator dimerization in live bacteria. This approach uses fluorescent protein probes and measures oligomerization-dependent depolarization of excitation light .

6. Solid-State NMR Studies:
Solid-state NMR in conjunction with crystallography, solution NMR, and distance measurements has proven effective for investigating transmembrane signaling mechanisms of membrane-embedded histidine kinases. This approach can reveal:

  • Conformational changes upon ligand binding

  • Transmembrane signal transduction mechanisms

  • Quaternary structure rearrangements in cytosolic domains

When designing experiments to study DltS interactions, researchers should consider:

  • The native oligomeric state of DltS (likely dimeric)

  • The potential for interactions with both membrane and soluble proteins

  • The dynamic nature of signaling complexes

  • The requirement for specific lipid compositions that might influence protein function

How can researchers overcome solubility and stability issues with recombinant DltS protein?

Membrane proteins like DltS often present solubility and stability challenges. Here are evidence-based strategies to address these issues:

Improving Solubility:

  • Fusion Tag Optimization:

    • SUMO, MBP, or Trx tags can enhance solubility more effectively than His-tags alone

    • Consider dual-tagging strategies (e.g., His-MBP-DltS) with protease cleavage sites

  • Expression Condition Modifications:

    • Reduce induction temperature to 16-18°C

    • Decrease IPTG concentration to 0.1-0.2 mM

    • Use specialized media formulations like Terrific Broth with added glucose

  • Detergent Screening:
    Systematically test multiple detergent types and concentrations:

    Detergent TypeWorking ConcentrationBest For
    DDM0.03-0.1%Mild extraction, maintains function
    LMNG0.01-0.05%Enhanced stability over DDM
    CHAPS0.5-1%Good for preliminary extraction
    Digitonin0.1-0.5%Very mild, preserves complexes
    SDS0.1-0.5%Strong solubilization (may denature)
  • Lipid Addition:

    • Supplement purification buffers with specific lipids (0.01-0.1 mg/mL)

    • Consider using lipid nanodiscs or bicelles for reconstitution

Enhancing Stability:

  • Buffer Optimization:

    • Test pH range (typically 6.5-8.0)

    • Optimize salt concentration (150-500 mM NaCl)

    • Include glycerol (10-20%) to prevent aggregation

    • Add reducing agents (1-5 mM DTT or TCEP)

  • Stabilizing Additives:

    • Nucleotides: ATP/ADP (1-5 mM) can stabilize kinase domains

    • Divalent cations: MgCl₂ or MnCl₂ (5-10 mM)

    • Osmolytes: trehalose (5-10%), sucrose (5-10%), or arginine (50-200 mM)

  • Storage Recommendations:

    • Store at high concentration (>1 mg/mL) to minimize surface denaturation

    • Add 6% trehalose for lyophilization

    • Avoid repeated freeze-thaw cycles

    • Store working aliquots at 4°C for up to one week

  • Protein Engineering Approaches:

    • Consider expressing stable subdomains if full-length protein is problematic

    • Identify and mutate surface-exposed hydrophobic residues

    • Introduce disulfide bonds to stabilize tertiary structure

Case-Specific Recommendations for DltS:
Based on available data for similar histidine kinases, researchers working with DltS should particularly consider:

  • Including the cognate response regulator during purification to stabilize certain conformations

  • Testing amphipols as alternatives to detergents for long-term stability

  • Using hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify unstable regions that could be targeted for engineering

Systematic documentation of conditions tested and their outcomes is essential for optimizing DltS preparation protocols.

What are the most common pitfalls in DltS functional assays and how can they be avoided?

Researchers working with DltS and other sensor histidine kinases frequently encounter several challenges in functional assays. Here are the most common pitfalls and evidence-based strategies to overcome them:

Inadequate Protein Activity

PitfallPrevention StrategyTroubleshooting Approach
Loss of activity during purificationInclude ATP, Mg²⁺, and glycerol in all buffersTest activity at each purification step to identify where activity is lost
Improper foldingExpress at lower temperatures (16-18°C)Try different fusion tags or co-expression with chaperones
Inactive conformationInclude physiological ligands during purificationReconstitute in lipid environment rather than detergent micelles
Oxidation of critical cysteinesMaintain reducing conditions with DTT or TCEPPerform purification under inert gas (N₂) for highly sensitive proteins

Phosphorylation Assay Challenges

  • Low Signal Issues:

    • Ensure fresh ATP/[γ-³²P]ATP (degradation occurs during storage)

    • Optimize Mg²⁺ concentration (typically 5-10 mM)

    • Include phosphatase inhibitors if necessary

    • For Western blot detection, use Phos-tag gels for better separation

  • High Background:

    • Perform thorough blocking when using antibodies

    • Include negative controls (kinase-dead mutant)

    • For radiometric assays, ensure thorough washing of membranes or gels

  • Inconsistent Results:

    • Standardize protein:ATP ratios

    • Control reaction temperature precisely

    • Ensure all components are at consistent concentrations between experiments

Signal Transduction Measurement Challenges

  • In Fluorescence-Based Assays:

    • Control for photobleaching by including appropriate controls

    • Minimize exposure times and light intensity

    • Ensure fluorophores don't interfere with protein function

  • In Real-Time Measurements:

    • Account for temperature-dependent changes in fluorescence

    • Standardize cell density for in vivo measurements

    • Include proper controls for autofluorescence

Physiological Relevance Concerns

  • Artificial Conditions:

    • Reconstitute in lipid compositions that mimic native membrane

    • Include physiologically relevant ion concentrations

    • Consider the oligomeric state of the protein (likely dimeric for DltS)

  • Specific DltS Considerations:

    • Based on research with similar histidine kinases, include the native response regulator

    • Test activity in the presence of potential physiological stimuli related to cell wall stress

    • Consider the impact of teichoic acid fragments or antimicrobial peptides as potential signals

Data Interpretation Pitfalls

  • Overinterpretation:

    • Establish dose-response relationships rather than single-point measurements

    • Compare relative activities rather than absolute values between different protein preparations

    • Verify key findings with complementary assays

  • Technical Artifacts:

    • Include proper controls for non-specific phosphorylation

    • Validate antibody specificity if using phospho-specific antibodies

    • Consider the impact of detergents on assay readouts

Recommended Validation Approaches:
To ensure reliable results when working with DltS, researchers should:

  • Confirm protein activity through multiple independent methods

  • Demonstrate specificity of response to known stimuli

  • Correlate in vitro findings with in vivo phenotypes when possible

  • Use site-directed mutagenesis of key residues (catalytic histidine, ATP-binding site) as controls

By anticipating these common pitfalls, researchers can design more robust experiments that yield reliable insights into DltS function.

How should researchers analyze and interpret Deep-Level Transient Spectroscopy (DLTS) data in the context of DltS studies?

While Deep-Level Transient Spectroscopy (DLTS) is traditionally used for studying defects in semiconductors , adapted spectroscopic techniques can be valuable for analyzing conformational changes and binding events in sensor proteins like DltS. Here's a comprehensive guide for researchers:

Principles for Adapting DLTS to Protein Studies:

  • Conceptual Adaptation:

    • In semiconductors, DLTS measures capacitance transients from charge carrier traps

    • For proteins, analogous measurements track conformational changes or binding-induced electronic transitions

    • Focus on temperature-dependent emission rates to derive activation energies for conformational changes

  • Experimental Setup Considerations:

    • Use specialized sample holders that accommodate protein solutions or membrane preparations

    • Apply voltage pulses that won't denature proteins (typically <1V)

    • Maintain sample hydration and physiological pH throughout measurements

Data Acquisition Guidelines:

  • Parameter Selection:

    • Temperature range: Typically 77K to 300K (liquid nitrogen to room temperature)

    • Rate windows: Select appropriate time constants based on expected kinetics

    • Voltage pulse amplitude: Start with small amplitudes (100-200 mV) to avoid denaturation

  • Controls and Calibration:

    • Measure buffer-only samples to establish baseline

    • Use proteins with well-characterized conformational changes as positive controls

    • Perform measurements on mutant proteins (e.g., active site mutants) for comparison

Data Analysis Methodology:

  • Arrhenius Analysis:

    • Plot ln(T²/e) versus 1000/T where e is the emission rate and T is temperature

    • Activation energy (Ea) can be calculated from the slope: Ea = -k × slope

    • Compare activation energies across different conditions (e.g., with/without ligands)

  • Signal Processing:

    • Apply digital filtering to reduce noise (e.g., Savitzky-Golay filtering)

    • Use deconvolution techniques for overlapping signals

    • Implement baseline correction algorithms specific to your instrument

  • Quantitative Parameters:
    For protein studies, adapt the key DLTS parameters:

    ParameterTraditional DLTS MeaningProtein Study Interpretation
    Activation Energy (Ea)Trap energy levelEnergy barrier for conformational change
    Capture Cross Section (σn)Defect capture probabilityBinding site accessibility
    Signal Amplitude (ΔC)Trap concentrationConcentration of active binding sites

Interpretation Guidelines for DltS Studies:

  • Binding Events:

    • Changes in activation energy may indicate ligand binding

    • Reduced activation energy suggests stabilization of a particular conformation

    • Multiple peaks may represent different binding sites or conformational states

  • Structure-Function Relationships:

    • Compare wild-type DltS with mutants affecting key domains

    • Correlate spectroscopic changes with functional outcomes (e.g., phosphorylation activity)

    • Look for temperature-dependent transitions that might represent physiologically relevant conformational changes

  • Data Visualization:

    • Create 3D plots of signal intensity versus temperature and rate window

    • Use difference spectra to highlight changes induced by specific conditions

    • Integrate findings with other structural data (e.g., from crystallography or NMR)

Integration with Complementary Methods:

DLTS-derived data should be validated with complementary techniques:

  • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Circular dichroism (CD) for secondary structure changes

  • Fluorescence-based assays for real-time monitoring of conformational changes

  • Molecular dynamics simulations to interpret energy landscapes

By carefully adapting DLTS methodology to protein studies, researchers can gain valuable insights into the conformational dynamics and binding properties of sensor histidine kinases like DltS.

How can researchers create comprehensive data tables for DltS protein characterization studies?

Creating comprehensive, well-organized data tables is essential for effective reporting and analysis of DltS characterization studies. Below are guidelines and templates for different types of DltS-related experiments:

1. Protein Expression and Purification Data Table:

Expression ConditionOD₆₀₀ at InductionIPTG Concentration (mM)Temperature (°C)Duration (h)Cell Wet Weight (g/L)Protein Yield (mg/L)Purity (%)Specific Activity*
LB, BL21(DE3)0.60.53743.20.8750.12
LB, BL21(DE3)0.80.218163.82.1920.45
2xYT, BL21(DE3)pLysS0.80.116204.53.2950.62

*Specific activity: μmol phosphate transferred/min/mg protein

2. Kinetic Parameter Table for Autophosphorylation:

DltS Variantk₍ₐₚₚ₎ (min⁻¹)K_m for ATP (μM)Temperature Optimum (°C)pH OptimumMg²⁺ Requirement (mM)Half-life at 25°C (h)
Wild-type0.42 ± 0.05125 ± 18307.5108.5
H166A<0.01NDNDNDNDND
ΔPASdomain0.08 ± 0.02310 ± 45287.0152.3

ND = Not Determined

3. Ligand Binding Parameters:

LigandTechniqueK_d (μM)ΔH (kcal/mol)ΔS (cal/mol/K)n (Stoichiometry)Effect on Autophosphorylation
ATPITC85 ± 12-6.8-5.21.1Substrate
Antimicrobial peptide XSPR12.5 ± 2.3NDNDND2.3-fold activation
Cell wall fragment YFluorescence34 ± 8NDND0.580% inhibition

4. Structure-Function Relationship Data:

DomainResidue(s)MutationEffect on ExpressionEffect on Structure*Effect on Function**Phenotypic Impact
PASW120W120ANo changeMinor local change65% reduction in ATP bindingReduced antimicrobial resistance
DHpH166H166ANo changeNo changeComplete loss of autophosphorylationNull phenotype
TransmembraneP45P45AReduced by 40%Altered helical bending80% reduction in signal transductionImpaired response to cell wall stress

*Based on CD spectroscopy or thermal stability measurements
**Relative to wild-type activity

5. Comprehensive D-Alanylation Activity Data Table:

StrainDltS StatusD-Ala Content in TAs (μmol/mg)Surface Charge (mV)Autolysis Rate*MIC for Polymyxin B (μg/mL)Survival in Neutrophil Killing Assay (%)
Wild-typeNormal0.85 ± 0.12+15.30.086445.3
ΔdltSAbsent0.12 ± 0.04-22.70.3548.2
dltS++Overexpressed1.45 ± 0.18+28.60.0512862.8
H166AInactive0.15 ± 0.05-20.30.32810.5

*Rate constant (OD₆₀₀ decrease/min)

Recommendations for Creating Effective Data Tables:

  • Structure:

    • Organize data hierarchically from basic to complex characterization

    • Use consistent units throughout all tables

    • Include both raw data and calculated parameters where appropriate

  • Statistical Rigor:

    • Always include standard deviations or error measurements

    • Specify number of replicates (n) for each measurement

    • Indicate statistical significance where comparisons are made

  • Contextual Information:

    • Include experimental conditions in table footnotes

    • Reference specific methodologies used for each measurement

    • Define any abbreviations or specialized terms

  • Integration with Text:

    • Reference tables explicitly in manuscript text

    • Highlight key findings without duplicating all table data in text

    • Use tables for comprehensive data presentation and text for interpretation

  • Data Visualization:

    • Consider complementing complex tables with graphical representations

    • Use heat maps for large comparative datasets

    • Provide structure-function correlation diagrams where appropriate

By following these guidelines, researchers can create data tables that facilitate comprehensive analysis and clear communication of DltS characterization results in scientific publications.

What are the most promising directions for future research on DltS and related sensor proteins?

Based on current knowledge gaps and technological advances, several promising research directions emerge for DltS and related sensor proteins:

1. Structural Biology Frontiers:

  • Cryo-EM of Full-Length DltS: Capturing the complete transmembrane protein in different functional states

  • Time-Resolved Structural Studies: Using techniques like time-resolved crystallography or TR-SAXS to capture transient conformational states during signaling

  • Membrane-Embedded Structures: Developing better methods to determine structures of DltS within its native lipid environment

  • Conformational Dynamics: Applying hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map dynamic regions during signaling

2. Signaling Mechanism Exploration:

  • Single-Molecule Studies: Applying techniques like smFRET to observe individual DltS molecules during signaling events

  • Allostery Mapping: Systematically identifying allosteric networks connecting sensor domains to kinase activity centers

  • Phosphorylation Cascade Kinetics: Developing real-time assays to monitor entire signaling cascades from stimulus perception to transcriptional response

  • Cross-Talk Identification: Exploring how DltS signaling integrates with other cellular pathways

3. Physiological Role and Regulation:

  • Natural Ligands: Identifying the specific stimuli or ligands that activate DltS in vivo

  • Signal Integration: Understanding how DltS processes multiple environmental inputs

  • Spatiotemporal Regulation: Investigating potential localization patterns of DltS in bacterial membranes and their functional significance

  • Accessory Proteins: Identifying proteins that modulate DltS activity through direct interactions

4. Technological Innovations:

  • Biosensor Development: Engineering DltS-based biosensors for detecting specific environmental stimuli or antimicrobial compounds

  • Optogenetic Control: Creating light-responsive variants of DltS for precision control of bacterial signaling

  • Direct In Vivo Observation: Developing improved methods for real-time detection of response regulator phosphorylation dynamics in live bacteria

  • High-Throughput Screening: Establishing platforms to identify modulators of DltS activity for antimicrobial development

5. Translational Applications:

  • Antimicrobial Development: Targeting DltS and the D-alanylation pathway to sensitize bacteria to host immune defenses

  • Biofilm Control: Exploiting the role of DltS in biofilm formation to develop anti-biofilm strategies

  • Virulence Modulation: Attenuating bacterial pathogenicity by interfering with DltS-mediated signaling

  • Synthetic Biology: Using engineered DltS variants in synthetic signaling circuits

6. Multi-Omics Integration:

  • Systems Biology Approaches: Combining transcriptomics, proteomics, and metabolomics to map the complete DltS regulon

  • Computational Modeling: Developing predictive models of how perturbations to DltS signaling affect bacterial physiology

  • Evolutionary Studies: Conducting comparative genomics to understand the evolution of DltS and its signaling specificity across bacterial species

  • Host-Microbe Interactions: Exploring how DltS-mediated responses influence interactions with host immune systems

Specific High-Impact Research Questions:

  • What is the molecular mechanism by which DltS senses its environmental stimuli, and how is this signal transmitted across the membrane?

  • How does the DHp helical bending and CA domain swing movement coordinate to regulate autophosphorylation activity?

  • What is the role of DltS in controlling bacterial autolysis and how might this be exploited therapeutically?

  • How do post-translational modifications beyond phosphorylation regulate DltS activity?

  • Can DltS inhibitors effectively restore antibiotic sensitivity in resistant bacteria by interfering with cell wall charge?

By pursuing these research directions, scientists can gain deeper insights into bacterial signaling mechanisms and potentially develop novel strategies for controlling bacterial infections.

How can researchers effectively combine traditional techniques with emerging technologies to advance DltS research?

Effectively advancing DltS research requires strategic integration of traditional approaches with cutting-edge technologies. Here's a comprehensive framework for researchers:

Integration Framework for DltS Research:

1. Structure-Function Studies:

Traditional TechniqueEmerging TechnologyIntegration StrategyExpected Advance
X-ray crystallographyCryo-electron microscopyUse crystallography for domain structures and cryo-EM for full-length proteinComplete structural understanding of signaling conformations
MutagenesisDeep mutational scanningCreate comprehensive mutant libraries and screen for functionIdentification of all critical residues for signaling
Biochemical assaysSingle-molecule techniques (smFRET)Correlate bulk activity with single-molecule dynamicsCapturing transient states in signaling pathway

2. Signaling Mechanism Analysis:

Traditional TechniqueEmerging TechnologyIntegration StrategyExpected Advance
Radioactive phosphorylation assaysReal-time fluorescence polarizationUse radiometric methods for validation of fluorescence-based techniquesTemporal resolution of signaling cascade
Western blottingMass spectrometry imagingCombine for spatial and identity confirmationComplete phosphoproteome during signaling
Genetic knockoutsCRISPR interference (CRISPRi)Use tunable repression to create activity gradientsDose-dependent effects on signaling networks

3. Physiological Role Investigation:

Traditional TechniqueEmerging TechnologyIntegration StrategyExpected Advance
Gene expression analysisSingle-cell RNA-seqMap population-level changes to cell-to-cell variabilityHeterogeneity in response to signaling
Phenotypic assaysBacterial cytological profilingLink molecular mechanisms to morphological changesComprehensive phenotypic signatures
Antibiotic sensitivity testingMicrofluidic gradient platformsDynamic monitoring of resistance developmentTemporal adaptation patterns

4. Implementation Guidelines:

For Academic Research Settings:

  • Cross-disciplinary Collaboration: Partner with:

    • Structural biologists for advanced imaging techniques

    • Biophysicists for single-molecule studies

    • Computational biologists for modeling signaling networks

  • Technology Development Pathway:

    • Begin with established techniques for baseline data

    • Validate new methods against traditional standards

    • Scale to high-throughput approaches once validated

  • Resource Optimization Strategies:

    • Core facility utilization for expensive technologies

    • Prioritize technique selection based on specific research questions

    • Consider equipment sharing arrangements between research groups

Practical Implementation Example: Comprehensive DltS Characterization Project

Phase 1: Foundational Characterization

  • Express and purify recombinant DltS using established protocols

  • Perform basic biochemical characterization (autophosphorylation, ATP binding)

  • Generate key mutants (catalytic histidine, PAS domain)

Phase 2: Structural Analysis Integration

  • Solve crystal structures of individual domains

  • Use HDX-MS to identify dynamic regions

  • Apply cryo-EM for full-length structure in nanodiscs

  • Validate structural insights with targeted mutagenesis

Phase 3: Signaling Mechanism Dissection

  • Apply real-time detection methods for response regulator phosphorylation

  • Use fluorescence-based techniques to monitor conformational changes

  • Implement in vivo FRET sensors for pathway activation

  • Validate with traditional biochemical assays

Phase 4: Physiological Impact Assessment

  • Analyze effects on D-alanylation using mass spectrometry

  • Evaluate antimicrobial resistance patterns

  • Examine autolysis phenotypes

  • Connect molecular mechanisms to bacterial fitness

Phase 5: Translational Applications

  • Screen for modulators of DltS activity

  • Develop biosensors based on engineered DltS variants

  • Test combination strategies with existing antibiotics

Critical Success Factors:

  • Method Validation:

    • Establish clear benchmarks for new techniques

    • Use orthogonal methods to confirm key findings

    • Implement appropriate controls for novel approaches

  • Data Integration:

    • Develop computational pipelines for multi-omic data analysis

    • Use standardized formats to facilitate data sharing

    • Implement machine learning for pattern recognition across diverse datasets

  • Research Timelines:

    • Allocate sufficient time for technology optimization

    • Build in validation checkpoints before advancing to next phase

    • Allow for iterative refinement based on initial findings

By strategically combining traditional and emerging technologies, researchers can accelerate discoveries about DltS function and develop novel approaches to modulate bacterial signaling for therapeutic purposes.

What are the broader implications of DltS research for understanding bacterial signaling and antibiotic resistance?

DltS research extends beyond its specific molecular mechanisms to provide critical insights into fundamental aspects of bacterial physiology, host-pathogen interactions, and antimicrobial resistance. The broader implications span multiple domains of microbiology and infectious disease research:

Fundamental Understanding of Bacterial Signaling:

  • Signaling Architecture Paradigms:

    • DltS exemplifies how bacteria use two-component systems to sense and respond to environmental stimuli

    • Research on DltS illuminates general principles of signal transduction across membranes

    • Understanding DltS reveals how conformational changes propagate through protein domains to regulate enzymatic activity

  • Signal Integration Mechanisms:

    • DltS studies reveal how bacteria process complex environmental information

    • Research shows how multiple inputs can converge on a single signaling pathway

    • Findings demonstrate the sophisticated decision-making capabilities of seemingly simple organisms

Cell Envelope Homeostasis and Antimicrobial Resistance:

  • Cell Wall Modification Systems:

    • DltS-controlled D-alanylation represents a critical adaptive mechanism for bacteria

    • This modification directly impacts susceptibility to antimicrobial compounds

    • Understanding these pathways reveals potential vulnerabilities in bacterial defenses

  • Resistance Mechanism Diversity:

    • DltS research highlights non-traditional resistance mechanisms beyond drug efflux or target modification

    • D-alanylation of teichoic acids represents an "innate immunity" of bacteria against host defenses

    • These findings expand our conceptual framework for addressing antimicrobial resistance

  • Evolutionary Considerations:

    • DltS conservation across Gram-positive bacteria suggests fundamental importance

    • Studying DltS evolution provides insights into how bacterial defense mechanisms developed

    • This evolutionary perspective can guide more sustainable antimicrobial development strategies

Host-Pathogen Interaction Dynamics:

  • Immune Evasion Strategies:

    • DltS-mediated D-alanylation impedes the sensing of bacterial peptidoglycan by host immune systems

    • This mechanism represents a sophisticated immune evasion strategy

    • Understanding these interactions helps explain persistent and recurrent infections

  • Microbiome Stability:

    • D-alanylation is essential for the resistance of certain bacteria to intestinal lysozyme

    • This finding explains how commensal bacteria maintain stable colonization

    • DltS research thus has implications for microbiome engineering and stability

Therapeutic Innovation Pathways:

  • Novel Drug Target Identification:

    • DltS represents a potential antivirulence target that doesn't directly kill bacteria

    • Targeting DltS could sensitize bacteria to existing host defenses

    • This approach may exert less selective pressure for resistance development

  • Combination Therapy Approaches:

    • Inhibiting DltS could potentiate the effects of conventional antibiotics

    • This strategy aligns with current trends toward multi-target approaches to combat resistance

    • DltS inhibitors could restore efficacy of existing antimicrobial peptides

  • Diagnostic Applications:

    • Understanding DltS activity could lead to biomarkers for bacterial stress responses

    • These insights could enable more precise antimicrobial susceptibility testing

    • Real-time monitoring of bacterial adaptation could guide clinical decision-making

Synthetic Biology and Biotechnological Applications:

  • Engineered Signaling Systems:

    • DltS characterization provides blueprints for designing synthetic signaling pathways

    • These engineered systems could enable programmed bacterial behaviors for various applications

    • Potential applications include biosensing, bioproduction, and biomedical interventions

  • Cell Surface Engineering:

    • Manipulating DltS activity offers a route to controlling bacterial surface properties

    • This capability could enhance industrial applications of beneficial bacteria

    • Surface modifications could improve bacterial survival in harsh environments

Future Research Trajectory:

The expanding understanding of DltS signaling suggests several high-impact research directions:

  • Development of small-molecule inhibitors targeting DltS to combat antimicrobial resistance

  • Creation of engineered DltS variants with custom sensing capabilities for synthetic biology

  • Exploration of DltS homologs across diverse bacterial species to understand signaling evolution

  • Investigation of potential DltS-like signaling mechanisms in other domains of life

By continuing to elucidate the mechanisms and functions of DltS, researchers will gain valuable insights into bacterial adaptation, potentially leading to novel strategies for addressing the global challenge of antimicrobial resistance.

How should researchers prioritize different aspects of DltS research to maximize scientific impact?

Strategically prioritizing DltS research can maximize scientific impact and accelerate discoveries with translational potential. This framework provides evidence-based guidance for researchers to optimize their investigation of DltS and related sensor proteins:

Research Prioritization Matrix:

Research AspectCurrent Knowledge StatusImpact PotentialTechnical FeasibilityResource RequirementsRecommended Priority
Structural biology of full-length DltSLimited (domains only)Very HighModerateHigh★★★★☆
Natural ligand identificationLargely unknownVery HighModerateModerate★★★★★
Signaling mechanism elucidationPartially understoodHighHighModerate★★★★☆
Cell wall modification regulationWell-establishedModerateHighLow★★★☆☆
Antimicrobial resistance connectionEstablishedHighHighModerate★★★★☆
Inhibitor developmentEarly stageVery HighModerateHigh★★★★★

Strategic Decision Framework:

1. Short-Term Priorities (1-2 Years):

  • Natural Ligand Identification:

    • Rationale: Discovering the physiological signals that activate DltS would fundamentally advance understanding of its function

    • Approach: Implement systematic screening of cell wall fragments, antimicrobial peptides, and environmental stressors

    • Expected Impact: Would enable physiologically relevant functional studies and provide targets for structural biology

  • Signaling Mechanism Characterization:

    • Rationale: Understanding how signals propagate through DltS will reveal general principles applicable to other histidine kinases

    • Approach: Apply real-time detection methods for phosphorylation dynamics combined with mutational analysis

    • Expected Impact: Could identify critical control points for therapeutic intervention

2. Medium-Term Priorities (2-4 Years):

  • Full-Length Structural Biology:

    • Rationale: Complete structural understanding would transform our ability to design interventions

    • Approach: Combine cryo-EM with crystallography of domains and computational modeling

    • Expected Impact: Would enable structure-based design of DltS modulators

  • Host-Pathogen Interaction Studies:

    • Rationale: DltS's role in immune evasion presents opportunities for immunomodulatory approaches

    • Approach: Use infection models with DltS mutants and monitor immune activation

    • Expected Impact: Could identify new therapeutic strategies that enhance immune clearance of pathogens

3. Long-Term Priorities (4+ Years):

  • Inhibitor Development and Testing:

    • Rationale: DltS inhibitors represent a novel class of potential therapeutics

    • Approach: Structure-based design combined with high-throughput screening

    • Expected Impact: Could yield antibiotic potentiators with low resistance development potential

  • Synthetic Biology Applications:

    • Rationale: Engineered DltS variants could serve as biosensors or cellular control systems

    • Approach: Domain swapping and directed evolution to create sensors with novel specificities

    • Expected Impact: Could enable programmable bacterial behaviors for biotechnology applications

Resource Allocation Recommendations:

For Research Groups with Limited Resources:

  • Focus on aspects with high feasibility and moderate resource requirements

  • Establish strategic collaborations for more resource-intensive aspects

  • Concentrate on one or two priority areas rather than spreading efforts too thin

For Well-Resourced Research Programs:

  • Pursue parallel tracks addressing both fundamental mechanisms and applications

  • Invest in technology development that could benefit multiple research questions

  • Establish interdisciplinary teams spanning structural biology, microbiology, and drug development

Impact Maximization Strategies:

1. Synergistic Research Combinations:

  • Pair structural studies with functional validation

  • Combine in vitro mechanistic work with in vivo physiological studies

  • Connect molecular findings to clinical isolate characterization

2. Critical Knowledge Gaps to Target:

  • Conformational changes that couple ligand binding to kinase activation

  • Mechanism of signal transmission across the membrane

  • Identity of physiological DltS activators and inhibitors

  • Regulatory networks connecting DltS to broader stress responses

3. Translational Pathway Acceleration:

  • Establish early partnerships with antimicrobial development programs

  • Create standardized assays for DltS activity suitable for inhibitor screening

  • Develop animal models that specifically test DltS-related phenotypes

Implementation Considerations:

Researchers should regularly reassess priorities based on:

  • New technological developments that may change technical feasibility

  • Emerging discoveries that shift the knowledge landscape

  • Changes in funding priorities and clinical needs

  • Results from their own initial studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.