Recombinant Sensor protein qseC (qseC)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Sensor Protein QseC

Recombinant Sensor protein QseC (QseC) is a bacterial adrenergic receptor that plays a crucial role in interkingdom signaling . It is a histidine kinase (HK) receptor involved in quorum sensing, a mechanism by which bacteria respond to changes in cell population density . QseC is found in various bacterial species, including Escherichia coli and Salmonella .

Structure and Function

QseC has two transmembrane domains and a histidine kinase domain, suggesting its membrane location enables autophosphorylation when it senses specific environmental signals . As a transmembrane protein with histidine protein kinase, QseC activates in response to host and bacterial signals and phosphorylates the QseB response regulator, a transcription factor that regulates relevant virulence gene expression .

The QseC protein consists of:

  • A periplasmic signal-sensing domain

  • Two transmembrane domains

  • A cytoplasmic kinase domain

QseC functions as a receptor for the host hormones epinephrine/norepinephrine and the bacterial autoinducer AI-3, which are involved in cell-to-cell signaling . QseC does not share primary sequence homology with adrenergic receptors; hence, it may serve as a functional analog, not homolog, of these G protein-coupled receptors .

Mechanism of Action

QseC senses bacterial AI-3 signals and host epinephrine/norepinephrine hormones . QseC directly binds to these signals, and this binding can be blocked by the α-adrenergic antagonist phentolamine . Upon sensing these signals, QseC autophosphorylates and transfers the phosphate to its cognate response regulator, QseB . Phosphorylated QseB then binds to and activates the transcription of virulence genes .

QseC can control QseB activation via a mechanism that is independent of reverse phosphotransfer . QseC-mediated dephosphorylation is required for maintaining proper QseB-PmrB-PmrA interactions in Uropathogenic E. coli .

Role in Virulence and Pathogenesis

A qseC mutant is attenuated for virulence in a rabbit animal model, highlighting the importance of this signaling system in virulence in vivo . QseC is essential for the adaptation of A. actinomycetemcomitans to the host cell environment by detecting catecholamines and iron .

QseC is involved in various virulence-related functions, including:

  • Activation of flagella and motility genes

  • Adhesion lesion formation

  • Shiga toxin expression

  • Biofilm formation

  • Intracellular virulence in fish pathogen Edwardsiella tarda

Conservation and Distribution

An in silico search using the periplasmic (signal-sensing) domain of QseC reveals a high degree of conservation among different bacterial species . The QseC sensor is found in Shigella sp., Salmonella sp., Erwinia carotovora, Haemophilus influenzae, Pasteurella multocida, Actinobacillus pleuropneumoniae, Chromobacterium violaceium, Rubrivivax gelatinosus, Thiobacillus denitrificans, Ralstonia eutropa, Ralstonia metallidurans, and Psychrobacter sp . This search also revealed homology to a fungal protein of unknown function from Aspergillus nidulans . Taken together, these findings suggest that QseC may have an ancient evolutionary history .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
qseC; Z4378; ECs3908/ECs3909; Sensor protein QseC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-449
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
qseC
Target Protein Sequence
MKFTQRLSLRVRLTLIFLILASVTWLLSSFVAWKQTTDNVDELFDTQLMLFAKRLSTLDL NEINAADRMAQTPNKLKHGHVDDDALTFAIFTHDGRMVLNDGDNGEDIPYSYQREGFADG QLVGDKDQWRFVWMTSPDGKYRIVVGQEWEYREDMALAIVAGQLIPWLVALPVMLIIMMV LLGRELAPLNKLALALRMRDPDSEKPLNATGVPSEVRPLVESLNQLFARTHAMMVRERRF TSDAAHELRSPLTALKVQTEVAQLSDDDPQARKKALLQLHSGIDRATRLVDQLLTLSRLD SLDNLQDVAEIPLEDLLQSSVMDIYHTAQQAKIDVRLTLNVQGIKRTGQPLLLSLLVRNL LDNAVRYSPQGSVVDVTLNADNFIVRDNGPGVTPEALARIGERFYRPPGQTATGSGLGLS IVQRIAKLHGMNVEFGNAEQGGFEAKVSW
Uniprot No.

Target Background

Function
Recombinant Sensor protein qseC is a member of the two-component regulatory system QseB/QseC. It activates the flagella regulon by upregulating FlhDC transcription and may activate QseB through phosphorylation.
Database Links

KEGG: ece:Z4378

STRING: 155864.Z4378

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is QseC and what is its basic function in bacteria?

QseC is a bacterial sensor histidine kinase that functions as a bacterial adrenergic receptor, forming part of the QseBC two-component system. It serves as a bacterial receptor for host epinephrine/norepinephrine and bacterial autoinducer-3 (AI-3), mediating interkingdom signaling between bacteria and their hosts. Upon sensing these signals, QseC autophosphorylates and subsequently phosphorylates its cognate response regulator, QseB, which activates transcription of various virulence genes . QseC is primarily distributed among members of the Enterobacteriaceae and Pasteurellaceae families, with conservation of an acidic motif in the sensor domain that is essential for signal recognition .

How does QseC's structure relate to its function as a bacterial adrenergic receptor?

QseC is a transmembrane protein with a periplasmic sensing domain and a cytoplasmic histidine kinase domain. The periplasmic domain is responsible for signal recognition (AI-3, epinephrine, norepinephrine), while the kinase domain initiates the phosphorylation cascade. When reconstituted into liposomes for in vitro studies, QseC adopts an inside-out orientation with the periplasmic sensing domain inside the liposomes and the kinase domain outside, which allows for the study of signal transduction mechanisms . Although QseC functions as a bacterial adrenergic receptor, it does not share primary sequence homology with mammalian adrenergic receptors, suggesting it serves as a functional analog rather than a homolog of G protein-coupled receptors .

What is the relationship between QseC and QseB in bacterial signaling?

QseC and QseB form a cognate two-component system where:

  • QseC serves as the sensor histidine kinase that autophosphorylates upon signal detection

  • QseB functions as the response regulator that receives a phosphate from QseC

  • Phosphorylated QseB binds to and activates transcription of target genes

In experimental systems, QseC initiates autophosphorylation after approximately 10 minutes in the presence of epinephrine and transfers its phosphate to QseB after 30 minutes . After 120 minutes, QseC transfers a large proportion of its phosphate to QseB, confirming the functional relationship of this two-component system . Interestingly, QseC also plays a critical role in dephosphorylating QseB, which is essential for maintaining proper QseB activation levels and preventing cross-talk with other two-component systems .

How can recombinant QseC be expressed and purified for in vitro studies?

For functional studies of QseC, researchers typically:

  • Express QseC with an affinity tag (e.g., MycHis-tag) under native conditions

  • Purify the protein using affinity chromatography

  • Reconstitute the purified protein into liposomes to mimic its membrane-bound state

When reconstituted into liposomes, QseC adopts an inside-out orientation that can be verified by:

  • Western blot analysis using anti-tag antibodies without disrupting the liposomes

  • Confirming the accessibility of ATP to the kinase site without liposome disruption

This experimental setup allows for the study of signal binding, autophosphorylation, and phosphotransfer to QseB in a controlled environment .

What methods are used to study QseC-mediated phosphorylation and dephosphorylation?

To study QseC phosphorylation dynamics, researchers employ several approaches:

For autophosphorylation assays:

  • Reconstitute QseC into liposomes

  • Add [γ-32P]dATP as a phosphate donor

  • Introduce signaling molecules (AI-3, epinephrine, norepinephrine) at specific concentrations

  • Measure phosphorylation levels over time using radiography

For phosphotransfer assays:

  • Load QseC liposomes with the signaling molecule (e.g., 50 μM epinephrine)

  • Add purified QseB protein and [γ-32P]dATP

  • Monitor phosphate transfer from QseC to QseB over time (typically 10-120 minutes)

For dephosphorylation studies:

  • Phosphorylate QseB (either using QseC or alternative methods)

  • Add QseC to the phosphorylated QseB

  • Monitor the decrease in QseB phosphorylation levels over time

These methods have revealed that while QseC readily phosphorylates QseB, its dephosphorylation activity varies depending on experimental conditions and bacterial species .

How can researchers assess QseC's sensing of different signals in experimental settings?

To evaluate QseC's ability to sense different signals, researchers can:

  • Liposome-based assays:

    • Load QseC liposomes with potential signals (AI-3, epinephrine, norepinephrine, iron)

    • Measure autophosphorylation activity using [γ-32P]dATP

    • Compare signal-induced phosphorylation levels to baseline

  • Competitive binding assays:

    • Add adrenergic antagonists (e.g., phentolamine at 50 μM) alongside signaling molecules

    • Determine whether antagonists block signal-induced autophosphorylation

    • This approach demonstrated that phentolamine can specifically block QseC responses to both AI-3 and epinephrine/norepinephrine

  • Transcriptional reporter assays:

    • Use reporter gene fusions (e.g., flhDC::lacZ) in wild-type and qseC mutant backgrounds

    • Expose bacteria to different signals and measure reporter gene expression

    • This approach showed that addition of either AI-3 or epinephrine to a luxS mutant restored flhDC transcription to wild-type levels, while addition of phentolamine blocked this activation

How does QseC distinguish between bacterial AI-3 and host hormones?

While QseC recognizes both bacterial AI-3 and host hormones (epinephrine/norepinephrine), research indicates some differences in signal recognition:

  • Structural recognition: QseC has a periplasmic sensing domain with conserved acidic residues critical for signal binding. These residues likely form binding pockets that accommodate both types of signals, though with potentially different binding affinities .

  • Signal specificity: QseC shows signal specificity by responding to AI-3 and epinephrine/norepinephrine but not to other bacterial autoinducers like AI-2. Experimental evidence showed that loading QseC liposomes with AI-2 (100 μM) did not induce significant autophosphorylation compared to liposomes without signal, while AI-3 (100 nM) significantly increased autophosphorylation to levels similar to epinephrine .

  • Species-dependent variations: Different bacterial species show variations in signal recognition. For example:

    • In E. coli, QseC responds to both AI-3 and epinephrine/norepinephrine

    • In Aggregatibacter actinomycetemcomitans, QseC is activated by a combination of epinephrine/norepinephrine and iron

    • In Haemophilus influenzae, only iron activates the sensor

This suggests evolutionary adaptations in QseC's sensing capabilities depending on the bacterial species' ecological niche.

What is the role of adrenergic antagonists in blocking QseC signaling?

Adrenergic antagonists, particularly α-adrenergic antagonists like phentolamine (PE), can specifically block QseC responses to both bacterial AI-3 and host epinephrine/norepinephrine signals. Research findings include:

  • Addition of 50 μM phentolamine to E. coli cultures resulted in decreased transcription of QseC-regulated genes like flhDC to levels similar to those observed in a qseC mutant .

  • The blocking effect appears to occur at the signal recognition level, preventing QseC autophosphorylation in response to both AI-3 and epinephrine/norepinephrine .

  • This antagonism suggests structural similarities between the binding sites for AI-3 and epinephrine/norepinephrine, and provides evidence for QseC functioning as a bacterial adrenergic receptor .

  • The ability of adrenergic antagonists to block QseC signaling presents potential therapeutic opportunities for developing novel antimicrobials that target this signaling pathway .

How does environmental iron interact with QseC signaling in different bacterial species?

Iron plays a variable role in QseC signaling across different bacterial species:

  • Species-dependent iron sensing:

    • In Aggregatibacter actinomycetemcomitans, QseC requires both epinephrine/norepinephrine and iron for activation

    • In Haemophilus influenzae, iron alone is sufficient to activate QseC

    • In E. coli, the role of iron in QseC activation is less established

  • Iron-dependent gene regulation:

    • In uropathogenic E. coli, adding ferric iron to the growth medium induced expression of qseBC in a PmrB-dependent manner, suggesting cross-talk between iron-sensing systems and QseC

    • This indicates that iron availability may modulate QseBC signaling through indirect mechanisms involving other two-component systems

  • Iron acquisition:

    • Studies in Haemophilus parasuis demonstrated that a qseC mutant had decreased ability for iron acquisition compared to the wild-type strain, suggesting QseC's involvement in iron utilization pathways

These findings suggest that iron sensing by QseC may be an adaptation to specific host environments where iron availability signals the presence of a suitable niche for colonization or infection.

How does QseC contribute to bacterial virulence in vivo?

QseC plays critical roles in bacterial virulence through multiple mechanisms:

  • Virulence gene activation: QseC signaling activates transcription of virulence genes in enterohemorrhagic E. coli O157:H7 and other pathogens .

  • In vivo virulence: A qseC mutant showed attenuated virulence in a rabbit animal model, demonstrating the importance of this signaling system for pathogenesis .

  • Virulence factor regulation: In enterohemorrhagic E. coli, QseC regulates:

    • Flagella and motility genes

    • Genes involved in AE (attaching and effacing) lesion formation

    • Shiga toxin expression

  • Species-specific virulence traits:

    • In non-typeable Haemophilus influenzae, QseC controls biofilm formation

    • In Salmonella Typhimurium, QseC influences motility and colonization of the gastrointestinal tract

    • In Edwardsiella tarda, QseC is involved in flagellar motility, fimbrial hemagglutination, and intracellular virulence

  • Stress response: Studies in Haemophilus parasuis demonstrated that QseC mediates resistance to environmental stresses including osmotic pressure, oxidative stress, and heat shock, which likely contributes to survival during infection .

The conservation of QseC across multiple pathogenic bacterial species and its consistent role in virulence makes it a promising target for broad-spectrum antimicrobial development .

What is the relationship between QseC-mediated quorum sensing and stress tolerance in bacteria?

QseC links quorum sensing to stress tolerance through several mechanisms:

  • Osmotic stress resistance:

    • In Haemophilus parasuis, a qseC deletion mutant (ΔqseC) exhibited decreased resistance to osmotic stress compared to the wild-type strain

    • Complementation of the mutant with a functional QseC restored osmotic stress resistance

  • Oxidative stress response:

    • The ΔqseC mutant showed increased sensitivity to oxidative stress

    • This suggests QseC may regulate genes involved in oxidative stress defense, which is critical during host-pathogen interactions where bacteria encounter reactive oxygen species

  • Heat shock response:

    • QseC contributes to bacterial heat shock resistance

    • This may enhance bacterial survival during fever or temperature fluctuations in the host

  • Environmental adaptation:

    • By sensing both bacterial population density (via AI-3) and host stress hormones (epinephrine/norepinephrine), QseC allows bacteria to integrate information about their environment and activate appropriate stress response pathways

    • This integration of quorum sensing with stress responses likely optimizes bacterial fitness during infection

The dual role of QseC in both virulence and stress tolerance represents an efficient regulatory system that allows bacteria to coordinate their response to changing environmental conditions during host colonization and infection.

How does the QseC receptor vary among different bacterial species and what are the functional implications?

QseC shows notable variation across bacterial species with important functional consequences:

  • Distribution and conservation:

    • QseC is primarily found in Enterobacteriaceae and Pasteurellaceae

    • The periplasmic sensing domain of QseC is highly conserved among species including Shigella sp., Salmonella sp., Erwinia carotovora, Haemophilus influenzae, Pasteurella multocida, and others

    • An in silico search also revealed homology to a fungal protein of unknown function from Aspergillus nidulans, suggesting possible ancient evolutionary origins

  • Signal recognition differences:

    • E. coli QseC responds to AI-3 and epinephrine/norepinephrine

    • A. actinomycetemcomitans QseC requires both epinephrine/norepinephrine and iron

    • H. influenzae QseC responds primarily to iron

  • Regulatory network variations:

    • In enterohemorrhagic E. coli, QseC induces expression of a second adrenergic TCS and phosphorylates two non-cognate response regulators

    • In A. actinomycetemcomitans, QseC signals through QseB to regulate genes involved in anaerobic metabolism and energy production

    • These differences suggest species-specific adaptations in QseC signaling pathways

  • Growth effects:

    • In H. parasuis, addition of 50 μM epinephrine reduced cell density in wild-type but had little effect on a ΔqseC mutant

    • This contrasts with reports in other bacteria where catecholamines promote growth, highlighting species-specific responses

These variations likely reflect adaptations to different host niches and environmental conditions, suggesting that QseC has evolved to optimize bacterial fitness in specific ecological contexts.

What cross-talk mechanisms exist between QseC and other two-component systems?

Research has revealed significant cross-talk between QseBC and other bacterial two-component systems:

  • QseC-PmrB cross-talk:

    • In uropathogenic E. coli, absence of QseC leads to robust, constitutive activation of QseB by the noncognate polymyxin resistance (Pmr) sensor kinase PmrB

    • PmrB exhibits kinetic preference for QseB similar to QseC but is significantly less efficient at dephosphorylating QseB

    • This results in increased levels of active QseB in qseC mutants

  • Transcriptional cross-regulation:

    • The PmrA response regulator contributes to qseB transcription in the absence of QseC

    • PmrA specifically binds the qseBC promoter, indicating direct regulation of qseBC gene transcription under physiological conditions

    • Addition of ferric iron to wild-type uropathogenic E. coli induced qseBC expression in a PmrB-dependent manner

  • Specificity of cross-talk:

    • Cross-talk is not promiscuous, as deletion of pmrB in a qseC mutant entirely suppressed QseB activation

    • No other sensors were identified that could phosphorylate QseB in the absence of QseC

  • Structural basis:

    • PmrB is the closest homolog of QseC in uropathogenic E. coli (37% sequence identity and 70% coverage)

    • The interacting interfaces of PmrB and QseC likely share common features enabling similar protein-protein interactions with QseB

This cross-talk represents an important consideration for researchers studying QseC function, as phenotypes observed in qseC mutants may partially result from inappropriate activation of QseB by PmrB rather than simply the loss of QseC signaling.

How do qseC mutations affect gene expression patterns in bacterial pathogens?

Mutations in qseC lead to complex alterations in gene expression profiles:

These findings highlight that QseC's regulatory impact extends beyond simple activation of target genes and involves complex regulatory networks that vary by bacterial species and environmental conditions.

What are the potential applications of QseC inhibitors in antimicrobial development?

QseC represents a promising target for novel antimicrobial development:

  • Rationale for targeting QseC:

    • QseC is conserved across multiple pathogenic bacterial species

    • It plays crucial roles in virulence gene expression

    • A qseC mutant is attenuated for virulence in animal models

    • Targeting QseC could potentially inhibit virulence without directly killing bacteria, potentially reducing selective pressure for resistance

  • Adrenergic antagonists as lead compounds:

    • α-adrenergic antagonists like phentolamine can block QseC signaling in response to both AI-3 and epinephrine/norepinephrine

    • These compounds could serve as starting points for developing more specific QseC inhibitors

  • Small molecule inhibitors:

    • Small molecule inhibitors targeting QseC already show promise as broad-spectrum antimicrobials

    • By interfering with bacterial communication and virulence activation, these compounds may represent a novel class of anti-virulence therapeutics

  • Potential advantages:

    • Anti-virulence approaches may exert less selective pressure for resistance compared to conventional antibiotics

    • QseC inhibitors could potentially be used in combination with traditional antibiotics

    • The conservation of QseC across multiple pathogens suggests broad-spectrum potential

  • Challenges to consider:

    • Species-specific variations in QseC function may affect inhibitor efficacy

    • Cross-talk with other two-component systems may complicate the effects of QseC inhibition

    • Delivery of inhibitors to the periplasmic sensing domain may present pharmacological challenges

Further characterization of QseC signaling mechanisms and species-specific variations will be essential for the successful development of QseC-targeted antimicrobials.

What are common challenges in expressing and purifying functional recombinant QseC?

Researchers working with recombinant QseC often encounter several technical challenges:

  • Membrane protein expression issues:

    • QseC is a transmembrane protein with multiple domains, making heterologous expression difficult

    • Expression may result in protein misfolding or aggregation

    • Recommended approach: Use bacterial expression systems with careful optimization of induction conditions (temperature, inducer concentration, duration)

  • Maintaining protein functionality:

    • The periplasmic sensing domain and cytoplasmic kinase domain must both remain functional

    • Native conformation is essential for signal recognition and kinase activity

    • Recommended approach: Use mild detergents or liposome reconstitution to maintain protein structure and function

  • Reconstitution into liposomes:

    • Proper orientation in liposomes is critical (typically inside-out with periplasmic domain inside)

    • Verification of orientation is essential for interpretation of results

    • Recommended approach: Verify orientation through antibody accessibility or kinase domain activity without liposome disruption

  • Signal stability:

    • Signals like AI-3 may have limited stability in experimental conditions

    • Recommended approach: Prepare fresh signal solutions and validate their activity with positive controls

  • Phosphorylation detection:

    • QseC autophosphorylation may be weak in some experimental conditions

    • Recommended approach: Use sensitive detection methods like radiography with [γ-32P]dATP and optimize reaction conditions based on published protocols

How can researchers address conflicting data regarding QseC function across different bacterial species?

When faced with conflicting data on QseC function, researchers should:

  • Consider species-specific variations:

    • QseC functions differently across bacterial species (E. coli vs. H. influenzae vs. A. actinomycetemcomitans)

    • Signal recognition varies (some respond to catecholamines only, others to iron only, others to both)

    • Systematically test multiple signals in your specific bacterial species

  • Standardize experimental conditions:

    • Growth conditions significantly affect QseC function

    • Medium composition, especially iron content, influences results

    • Temperature, pH, and oxygen availability all impact signaling

    • Standardize these parameters when comparing results across studies

  • Genetic background considerations:

    • Creation of clean deletion mutants without polar effects

    • Complementation with wild-type qseC at physiological expression levels

    • Control for plasmid copy number effects in complementation experiments

  • Cross-talk with other systems:

    • In qseC mutants, QseB can be inappropriately activated by PmrB

    • Consider creating double mutants (e.g., qseC/pmrB) to control for cross-talk

    • Measure phosphorylation state of QseB directly when possible

  • Phenotypic analysis:

    • Use multiple assays to assess QseC-dependent phenotypes

    • Include positive and negative controls in all experiments

    • Perform time-course experiments to capture dynamic responses

    • Consider that some phenotypes may be growth phase-dependent

What considerations are important when designing experiments to study QseC phosphorylation dynamics?

When studying QseC phosphorylation dynamics, researchers should consider:

  • Phosphorylation vs. dephosphorylation activities:

    • QseC functions both as a kinase and phosphatase toward QseB

    • PmrB readily phosphorylates QseB but is significantly less efficient at dephosphorylation

    • Design experiments to measure both activities independently

  • Temporal considerations:

    • QseC autophosphorylation initiates after approximately 10 minutes in the presence of signals

    • Phosphotransfer to QseB occurs after about 30 minutes

    • Substantial phosphotransfer may require 120 minutes or longer

    • Design time-course experiments that capture these kinetics

  • Signal concentrations:

    • Use physiologically relevant concentrations (e.g., 100 nM for AI-3, 50 μM for epinephrine)

    • Include concentration gradients to assess dose-response relationships

    • Control for potential signal degradation during experiments

  • Controls for specificity:

    • Include negative controls (no signal, unrelated signals like AI-2)

    • Use adrenergic antagonists (e.g., phentolamine at 50 μM) to confirm specificity

    • Consider creating point mutations in the QseC periplasmic domain to identify residues critical for signal recognition

  • In vitro vs. in vivo correlation:

    • Liposome-reconstituted QseC provides controlled conditions but may not perfectly recapitulate in vivo behavior

    • Complement in vitro findings with in vivo transcriptional reporter assays (e.g., qseB-regulated promoters fused to reporter genes)

    • Consider phosphoproteomic approaches to directly assess QseB phosphorylation states in vivo

How should researchers interpret conflicting growth phenotypes in QseC studies?

When encountering conflicting growth phenotypes in QseC research:

  • Reconcile contradictory observations:

    • Some studies report that epinephrine/norepinephrine promote bacterial growth

    • Others report no growth effect or even growth inhibition (as in H. parasuis)

    • These differences likely reflect species-specific responses and experimental conditions

  • Analysis framework:

    Bacterial SpeciesGrowth Effect of CatecholaminesProposed MechanismReference
    E. coli (some studies)Growth promotionEnhanced iron acquisition
    E. coli (other studies)No effectN/A
    H. parasuisGrowth reductionQseC-dependent signaling
    P. aeruginosaGrowth promotionUnclear
    Y. enterocoliticaGrowth promotionUnclear
  • Consider alternative explanations:

    • Iron availability in the medium may confound results

    • Growth phase at time of catecholamine addition affects outcomes

    • Concentration-dependent effects (stimulatory at low doses, inhibitory at high doses)

    • Strain-specific variations in QseC function or regulation

  • Recommended approach:

    • Standardize experimental conditions (medium, growth phase, signal concentration)

    • Include comprehensive controls (no signal, iron-repleted, iron-depleted)

    • Perform time-course experiments rather than single time-point measurements

    • Directly measure QseC activation (e.g., via reporter constructs) alongside growth measurements

How can researchers distinguish between direct and indirect effects of QseC signaling?

To differentiate direct from indirect QseC effects:

  • Transcriptional profiling approaches:

    • Compare wild-type, qseC mutant, and complemented strains using RNA-seq or microarrays

    • Identify genes with altered expression in the qseC mutant

    • Use bioinformatic analysis to predict potential QseB binding sites in promoter regions

    • Validate direct QseB targets using chromatin immunoprecipitation (ChIP) assays

  • Biochemical verification:

    • Express and purify QseB protein

    • Perform electrophoretic mobility shift assays (EMSAs) with potential target promoters

    • Use DNase footprinting to identify specific QseB binding sites

    • Mutate predicted binding sites and assess impact on QseB binding and gene expression

  • Phosphorylation dynamics:

    • Direct effects should show rapid changes following QseC activation

    • Indirect effects typically show delayed responses

    • Use time-course experiments to distinguish these patterns

  • Cross-talk considerations:

    • Create double mutants (e.g., qseC/pmrB) to control for activation by non-cognate sensors

    • Compare phenotypes to distinguish QseC-specific effects from those potentially mediated by cross-talk

  • Physiological relevance:

    • Confirm findings under multiple growth conditions

    • Validate in animal infection models when possible

    • Compare phenotypes across related bacterial species to identify conserved direct targets

What statistical approaches are recommended for analyzing QseC phosphorylation and gene expression data?

For robust analysis of QseC-related data:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.