Recombinant Sensor protein ZraS (zraS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your needs.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize development of the specified tag.
Synonyms
zraS; hydH; Z5579; ECs4926; Sensor protein ZraS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-458
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
zraS
Target Protein Sequence
MRFMQRSKDSLAKWLSAILPVVIVGLVGLFAVTVIRDYGRETAAARQTLLEKGSVLIRAL ESGSRVGMGMRMHHAQQQALLEEMAGQPGVRWFAVTDEQGTIVMHSNSGMVGKQLYSPQE MQQLHPGDEEVWRRIDSADGEPVLEIYRQFQPMFAAGMHRMRHMQQYAATPQAIFIAFDA SNIVSAEDREQRNTLIILFALATVLLASVLSFFWYRRYLRSRQLLQDEMKRKEKLVALGH LAAGVAHEIRNPLSSIKGLAKYFAERAPAGGEAHQLAQVMAKEADRLNRVVSELLELVKP THLALQAVDLNTLINHSLQLVSQDANCREIQLRFTANDTLPEIQADPDRLTQVLLNLYLN AIQAIGQHGVISVTASESGAGVKISVTDSGKGIAADQLEAIFTPYFTTKAEGTGLGLAVV HNIVEQHGGTIQVASLEGKGARFTLWLPVNITRKDPQG
Uniprot No.

Target Background

Function

Recombinant Sensor protein ZraS (zraS) is a member of the two-component regulatory system ZraS/ZraR. It functions as a membrane-associated protein kinase, phosphorylating ZraR in response to elevated zinc or lead concentrations in the growth medium.

Database Links

KEGG: ece:Z5579

STRING: 155864.Z5579

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ZraS and what is its role in bacterial systems?

ZraS is a histidine kinase sensor protein that functions as part of the Zra envelope stress response (ESR) two-component system (TCS) in bacteria. The complete Zra system consists of three components: ZraS (histidine kinase sensor), ZraR (response regulator), and ZraP (periplasmic repressor partner), making it atypical compared to standard two-component systems which typically have only two components . While activated by zinc, interestingly, the Zra system is not directly involved in zinc homeostasis or protection against zinc toxicity . Instead, the system appears to function as a sentinel that senses and responds to zinc entry into the periplasm, which serves as a marker of envelope stress perturbation .

How does ZraS structurally and functionally interact with metal ions?

ZraS binds one Zn²⁺ molecule with high affinity, resulting in conformational changes in its periplasmic domain . This conformational change is consistent with zinc serving as a triggering element for the system's activation. The interaction between ZraS and zinc can be characterized using multiple biophysical techniques including:

  • Multi-angle laser light scattering (MALLS)

  • Circular dichroism (CD)

  • Differential scanning fluorescence (DSF)

  • Inductively coupled plasma atomic emission spectroscopy (ICP-AES)

  • Small-angle X-ray scattering (SAXS)

It's worth noting that while ZraS binds zinc, its partner protein ZraP has been shown to bind copper with higher affinity than zinc in vitro, suggesting a complex interplay of metal sensing in the system .

What expression systems are optimal for recombinant ZraS production?

Multiple expression systems can be used for recombinant ZraS production, each with distinct advantages:

Expression SystemAdvantagesConsiderationsTypical Yield
E. coliHigh yield, rapid production, cost-effectiveLimited post-translational modificationsHighest among available systems
YeastGood yield, some post-translational modificationsLonger production time than E. coliModerate to high
Insect cells (baculovirus)Better post-translational modificationsMore complex system, higher costModerate
Mammalian cellsMost complete post-translational modificationsLowest yield, highest cost, longest production timeLow

What purification strategies yield the highest purity of recombinant ZraS?

The most effective purification strategy for recombinant ZraS typically involves affinity chromatography using His-tagged protein constructs. Based on available recombinant ZraS products, the following approach is recommended:

  • Expression of full-length ZraS (1-458aa) with an N-terminal His-tag in E. coli

  • Cell lysis under native conditions to preserve protein structure

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar matrices

  • Size exclusion chromatography to remove aggregates and ensure homogeneity

  • Final purity assessment via SDS-PAGE (target >90%)

For specific research applications requiring the periplasmic domain only, expression of just this domain has been successful in structural and functional studies .

How should recombinant ZraS be stored to maintain stability and activity?

To maintain stability and activity, recombinant ZraS should be stored following these guidelines:

  • Store the lyophilized powder at -20°C to -80°C upon receipt

  • After reconstitution, store working aliquots at 4°C for up to one week

  • For long-term storage, add glycerol to a final concentration of 5-50% (optimally 50%) and store in aliquots at -20°C to -80°C

  • Avoid repeated freeze-thaw cycles, as they can compromise protein integrity

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Buffer composition (Tris/PBS-based buffer with 6% Trehalose, pH 8.0) has been optimized for stability

These storage conditions are critical for maintaining the structural integrity and functional properties of ZraS for experimental use.

What methods are most effective for characterizing ZraS metal binding properties?

Characterizing ZraS metal binding properties requires a multi-technique approach. Based on successful studies, the following methods have proven most effective:

  • Inductively Coupled Plasma Atomic Emission Spectroscopy (ICP-AES): Provides precise quantification of metal content bound to ZraS

  • Circular Dichroism (CD): Detects conformational changes upon metal binding, confirming the structural impact of zinc interaction

  • Differential Scanning Fluorescence (DSF): Measures changes in thermal stability upon metal binding, indicating structural alterations

  • Small-Angle X-ray Scattering (SAXS): Reveals solution structure and conformational changes that occur upon metal binding

  • Isothermal Titration Calorimetry (ITC): While not explicitly mentioned in the search results, this technique would be valuable for determining binding affinity constants and thermodynamic parameters

A comprehensive approach combining these techniques provides the most complete characterization of metal binding properties, including stoichiometry, affinity, and structural consequences of binding.

How can researchers experimentally determine the activation mechanism of the ZraSR system?

Determining the activation mechanism of the ZraSR system requires a multi-faceted experimental approach:

  • In vitro phosphorylation assays: Using purified ZraS and ZraR proteins to measure zinc-dependent autophosphorylation of ZraS and subsequent phosphotransfer to ZraR

  • Conformational analysis: Comparing zinc-bound and zinc-free ZraS structures using SAXS and CD to document conformational changes that occur upon activation

  • Cross-linking experiments: Identifying protein-protein interactions between system components under various metal conditions

  • Reporter gene assays: Using in vivo systems with reporter constructs under the control of ZraR-regulated promoters to monitor system activation in response to various stimuli

  • Mutagenesis studies: Creating site-directed mutations in metal-binding residues to confirm their role in system activation

This integrated approach allows researchers to connect structural changes upon zinc binding to functional outcomes in signaling, providing a comprehensive view of the activation mechanism.

What is known about the regulatory relationship between ZraS, ZraR, and ZraP?

The regulatory relationship between ZraS, ZraR, and ZraP represents a complex interplay:

  • ZraS functions as a histidine kinase sensor that detects zinc in the periplasm

  • Upon zinc binding, ZraS undergoes conformational changes in its periplasmic domain, leading to activation of its kinase activity

  • Activated ZraS phosphorylates ZraR, which acts as a response regulator that controls gene expression

  • ZraP serves as a periplasmic accessory protein that plays a dual role:

    • Acts as a zinc-dependent chaperone with similarity to the CpxP protein in the related Cpx system

    • Functions as a repressor of the zraPSR operon expression when bound to zinc

  • The system appears to operate as a sentinel mechanism where zinc serves as a marker of envelope stress perturbation rather than directly regulating zinc homeostasis

This regulatory circuit shows similarities to the CpxPAR system, which responds to envelope perturbations including misfolded periplasmic proteins .

How do the structural features of ZraS relate to its function in the two-component system?

The structure-function relationship in ZraS reveals sophisticated molecular mechanisms:

ZraS contains distinct domains with specific functions:

  • The periplasmic domain contains the zinc-binding site, which undergoes conformational changes upon metal binding

  • The transmembrane domain transduces the signal across the membrane

  • The cytoplasmic domain contains the histidine kinase activity responsible for phosphorylation

The zinc-binding event in the periplasmic domain triggers conformational changes that propagate through the protein to activate the cytoplasmic kinase domain . This exemplifies a classic signal transduction mechanism across cellular compartments.

Unlike many metal-responsive systems that directly regulate metal homeostasis, the ZraSR system appears to use zinc as a marker of envelope stress, suggesting a more complex sensory role than simple metal detoxification . This makes ZraS a valuable model for studying how bacteria integrate multiple environmental signals through two-component systems.

What experimental approaches best investigate cross-talk between ZraSR and other stress response systems?

Investigating cross-talk between ZraSR and other stress response systems requires sophisticated experimental designs:

  • Transcriptomic profiling: RNA-seq or microarray analysis comparing wild-type, ΔzraS, and overexpression strains under various stress conditions to identify overlapping regulons

  • Chromatin immunoprecipitation sequencing (ChIP-seq) with tagged ZraR to identify binding sites throughout the genome and potential overlap with other response regulators

  • Protein-protein interaction studies using pull-down assays, bacterial two-hybrid systems, or co-immunoprecipitation to detect physical interactions between components of different systems

  • Epistasis analysis using genetic constructs with mutations in multiple systems to determine hierarchical relationships

  • Phosphotransfer profiling to test if ZraS can phosphorylate response regulators from other systems or if other histidine kinases can phosphorylate ZraR

These approaches would help determine the extent of cross-talk between ZraSR and functionally homologous systems such as CpxPAR, which also responds to envelope stress signals .

How can theoretical triangulation be applied to resolve contradictions in ZraS function studies?

Theoretical triangulation offers a robust framework for resolving contradictions in ZraS function studies:

  • Definition and application: Theoretical triangulation involves evaluating the usefulness of competing theories and testing rival hypotheses about the same phenomenon . For ZraS research, this would involve:

    • Identifying competing models of ZraS function (e.g., zinc homeostasis vs. envelope stress response)

    • Designing experiments that can differentiate between these models

    • Testing both models on the same experimental system

  • Implementation strategy:

    • Develop specific measurements for concepts and variables from each competing model

    • Design experiments that can simultaneously test predictions from different models

    • Analyze results to determine which model provides the best explanatory power

  • Example application: The apparent contradiction between ZraS responding to zinc yet not being involved in zinc resistance could be resolved by testing both a metal homeostasis model and an envelope stress model . By measuring both zinc-specific responses and general envelope stress markers simultaneously, researchers could determine which model better explains ZraS function.

Theoretical triangulation requires setting the objective of testing rival theories a priori, rather than retrospectively fitting data to different explanations .

What are common challenges in ZraS experimental studies and how can they be overcome?

Researchers commonly encounter several challenges when working with ZraS:

ChallengeCauseSolution
Low protein yieldToxicity of membrane protein overexpressionUse tightly controlled expression systems; express only the periplasmic domain for binding studies
Protein aggregationImproper folding of transmembrane domainsOptimize detergent selection; consider using fusion partners like MBP to enhance solubility
Inconsistent metal bindingVariable oxidation states of metal ionsStandardize metal ion preparation; control redox conditions during experiments
Degradation during purificationProtease activityInclude appropriate protease inhibitors; optimize purification speed
Loss of activity upon storageProtein destabilizationStore with 50% glycerol at -80°C; avoid repeated freeze-thaw cycles

Additionally, when reconstituting lyophilized ZraS protein, it's recommended to briefly centrifuge the vial prior to opening to bring contents to the bottom, and to reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

How can researchers effectively measure ZraS-mediated signaling activity?

Measuring ZraS-mediated signaling activity requires techniques that capture the phosphorelay dynamics and downstream effects:

  • In vitro phosphorylation assays:

    • Purify both ZraS and ZraR proteins

    • Incubate ZraS with ATP (typically ATP-γ-³²P for radioactive detection) in the presence and absence of zinc

    • Monitor ZraS autophosphorylation and subsequent phosphotransfer to ZraR

    • Quantify using SDS-PAGE followed by autoradiography or phosphorimaging

  • Reporter gene constructs:

    • Design reporter plasmids with a ZraR-regulated promoter controlling expression of a reporter gene (e.g., lacZ, GFP)

    • Transform these constructs into appropriate strains (wild-type, ΔzraS, ΔzraP)

    • Measure reporter activity under various conditions (zinc concentration, envelope stress)

    • Quantify the response using enzyme assays (for lacZ) or fluorescence measurements (for GFP)

  • Phosphorylated ZraR (ZraR-P) detection:

    • Use Phos-tag™ SDS-PAGE to separate phosphorylated from non-phosphorylated ZraR

    • Quantify the ratio as a measure of pathway activation

  • qRT-PCR of target genes:

    • Identify genes regulated by ZraR

    • Monitor their expression levels under various conditions

    • Use appropriate normalization controls

These approaches provide complementary data about ZraS signaling activity from in vitro biochemical events to in vivo physiological outcomes.

What experimental design considerations are crucial for valid ZraS functional studies?

Valid ZraS functional studies require careful experimental design:

  • Appropriate controls:

    • Include wild-type, ΔzraS, ΔzraR, and ΔzraP strains in parallel experiments

    • Use metal chelators as negative controls in metal-binding experiments

    • Include non-activating metals to confirm specificity

  • Consideration of environmental conditions:

    • Carefully control zinc and other metal ion concentrations in growth media

    • Monitor and adjust pH, which can affect metal solubility and binding

    • Consider the presence of other envelope stressors that might activate parallel pathways

  • Randomization and blinding:

    • When conducting complex experiments testing multiple hypotheses, randomize the order of experimental conditions

    • Consider blinding analysis when subjective measurements are involved

  • Appropriate statistical analysis:

    • Use statistical methods appropriate for the experimental design

    • Consider using quasi-experimental designs when randomization is not feasible

    • For time-series data on ZraS activation, interrupted time series (ITS) analysis may be appropriate

  • Validation across multiple techniques:

    • Confirm findings using orthogonal methods

    • Verify in vitro observations with in vivo experiments

    • Consider theoretical triangulation when faced with contradictory results

By carefully addressing these experimental design considerations, researchers can ensure the validity and reproducibility of their ZraS functional studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.