Recombinant Sensor-type histidine kinase prrB (prrB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees will apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If a specific tag type is required, please inform us; we will prioritize development to meet your specification.
Synonyms
prrB; BQ2027_MB0926C; Sensor-type histidine kinase PrrB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-446
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
prrB
Target Protein Sequence
MNILSRIFARTPSLRTRVVVATAIGAAIPVLIVGTVVWVGITNDRKERLDRRLDEAAGFA IPFVPRGLDEIPRSPNDQDALITVRRGNVIKSNSDITLPKLQDDYADTYVRGVRYRVRTV EIPGPEPTSVAVGATYDATVAETNNLHRRVLLICTFAIGAAAVFAWLLAAFAVRPFKQLA EQTRSIDAGDEAPRVEVHGASEAIEIAEAMRGMLQRIWNEQNRTKEALASARDFAAVSSH ELRTPLTAMRTNLEVLSTLDLPDDQRKEVLNDVIRTQSRIEATLSALERLAQGELSTSDD HVPVDITDLLDRAAHDAARIYPDLDVSLVPSPTCIIVGLPAGLRLAVDNAIANAVKHGGA TLVQLSAVSSRAGVEIAIDDNGSGVPEGERQVVFERFSRGSTASHSGSGLGLALVAQQAQ LHGGTASLENSPLGGARLVLRLPGPS
Uniprot No.

Target Background

Function
PrrB is a sensor-type histidine kinase belonging to the two-component regulatory system PrrB/PrrA. This system plays a crucial role in the early intracellular multiplication of Mycobacteria and is essential for bacterial viability. PrrB functions as a sensor kinase, undergoing autophosphorylation at a histidine residue. This phosphate group is then transferred to a conserved aspartic acid residue within the regulatory domain of PrrA. Subsequently, PrrA binds to upstream promoter regions of target genes, including its own, positively regulating their expression.
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is PrrB and what role does it play in bacterial physiology?

PrrB is a membrane-localized histidine kinase that forms part of the PrrBA two-component activation system in Rhodobacter sphaeroides. This system plays a critical role in regulating photosynthesis (PS) gene expression under oxygen-limiting or anaerobic conditions. The PrrB protein has bifunctional enzyme activity, possessing both kinase and phosphatase capabilities. When functioning in the kinase-dominant state, which occurs under low-oxygen conditions, PrrB phosphorylates the response regulator PrrA, resulting in the induction of photosynthesis gene expression .

What are the key structural components of PrrB?

PrrB consists of two structurally distinct regions:

  • A conserved C-terminal kinase/phosphatase domain that catalyzes phosphorylation/dephosphorylation reactions

  • An N-terminal membrane-spanning domain with six transmembrane helices that frame three periplasmic loops and two cytoplasmic loops

The membrane-spanning domain (amino acids 1-182) serves as the signal-sensing portion of the protein, while the C-terminal domain executes the enzymatic functions. The central portion of the transmembrane domain, particularly the second periplasmic loop and flanking transmembrane helices 3 and 4, is especially important for signal sensing and transduction .

How does PrrB respond to changes in oxygen levels?

PrrB functions within a signal transduction pathway involving the cbb₃ cytochrome c oxidase. Under aerobic conditions, electron flow through the cbb₃ oxidase generates an inhibitory signal that shifts PrrB activity from the kinase-dominant mode toward the phosphatase-dominant mode. This results in dephosphorylation of PrrA and subsequent repression of photosynthesis gene expression. The inhibitory signal is transduced to PrrB via the membrane-spanning PrrC protein. As oxygen levels decrease, electron flow through the cbb₃ oxidase diminishes, reducing the inhibitory signal and allowing PrrB to function predominantly as a kinase .

What is the "default state" of PrrB and why is this significant?

The intrinsic or "default state" of PrrB is in the kinase-dominant mode. This has been demonstrated through studies involving PrrB overexpression and mutations in the transmembrane domain. When PrrB is overexpressed, the excess protein lies outside the cbb₃-PrrBA signal transduction pathway and thus is not susceptible to the inhibitory signal, resulting in increased photosynthesis gene expression even under aerobic conditions. Similarly, when mutations disrupt the ability of PrrB to sense the inhibitory signal, the protein defaults to the kinase-dominant state .

This default state is significant because it indicates that the regulatory system is inherently biased toward activating photosynthesis genes, and repression requires an active signal generated under aerobic conditions. This evolutionary arrangement may ensure rapid adaptation to oxygen-limited environments .

How do mutations in the transmembrane domain affect PrrB function?

Mutations in different regions of the PrrB transmembrane domain have varying effects on its sensing and signaling capabilities. Research has shown that:

  • Mutations closer to the central portion of the transmembrane domain (particularly affecting periplasmic loop 2) more severely disrupt the protein's ability to respond to the inhibitory signal under aerobic conditions

  • Some mutations (like LP2 and LP4) result in constitutive expression of photosynthesis genes regardless of oxygen levels, suggesting these altered proteins are locked in a kinase-active conformation

  • Other mutations (LP1, LP5, and TM1Δ) lead to partial derepression of photosynthesis genes under aerobic conditions but still retain some ability to respond to changes in oxygen levels

  • Deletion of transmembrane helices 1 and 2, periplasmic loop 1, and cytoplasmic loop 1 (as in the TM1Δ mutant) does not completely eliminate oxygen sensing, indicating these regions are not essential for this function

These findings suggest that the second periplasmic loop and flanking transmembrane helices 3 and 4 are the most critical segments for the sensing function of PrrB .

What signaling features have been identified in the PrrB transmembrane domain?

A particularly notable feature of the PrrB transmembrane domain is the presence of a leucine-rich repeat in the region encompassing transmembrane helix 3, periplasmic loop 2, and transmembrane helix 4. This includes conserved leucine residues at positions 88, 94, 97, 98, 100, 104, 110, and 113. Leucine-rich repeats are found in various proteins and often mediate protein-protein interactions. This suggests that PrrB may receive signals from upstream components of the cbb₃-PrrBA pathway through direct protein interactions .

When the corresponding regions of PrrB homologs from several photosynthetic bacteria are aligned, this region shows notable conservation at the amino acid level, further supporting its functional importance in signal reception and transduction .

What effects does PrrB overexpression have on photosynthesis gene regulation?

Overexpression of the prrB gene leads to increased photosynthesis gene expression under aerobic conditions. This phenomenon has been demonstrated through experiments where multiple copies of prrB were introduced in trans into a PrrB null mutant strain. When prrB transcription was driven by a plasmid-borne tetracycline resistance promoter (with the prrB promoter completely removed), significant levels of light-harvesting complexes (B800-850 and B875) were produced even under 30% oxygen conditions .

This table summarizes the effects of different plasmid constructs on spectral complex formation under aerobic conditions:

StrainPlasmidB875 (nmol/mg protein)B800-850 (nmol/mg protein)puf Promoter Activity (units)
Wild typepRK415 (vector)NDND27 ± 1
PrrB1 (null)pA-9 (prrB under Tc promoter)1.62.295 ± 10
PrrB1 (null)pUI1649 (prrB under native promoter)NDND30 ± 2

ND = Not detected

Interestingly, when prrB was expressed from its own promoter, this effect was not observed, suggesting either that the native prrB promoter is too weak to allow sufficient expression or that the PrrBA system negatively regulates prrB expression when the native promoter is present .

How can researchers distinguish which regions of PrrB are important for sensing versus signal transduction?

Researchers can employ several complementary approaches to distinguish sensing from signal transduction functions:

  • Alanine insertion scanning: By inserting alanine residues at different positions throughout the transmembrane domain and measuring the effects on photosynthesis gene expression under varying oxygen conditions, researchers can identify regions critical for sensing. Mutants that become unresponsive to oxygen changes (like LP2 and LP4) identify regions essential for sensing .

  • Domain swapping experiments: Exchanging domains between PrrB and other histidine kinases can help determine which regions are specific to oxygen sensing versus general signal transduction.

  • Chimeric protein construction: Creating fusion proteins between the transmembrane domain of PrrB and signaling domains of other histidine kinases can reveal whether sensing and transduction functions can be separated.

  • Site-directed mutagenesis: Targeting conserved residues, particularly in the leucine-rich repeat region, can help determine which specific amino acids are involved in sensing versus signal propagation .

What techniques are effective for studying PrrB membrane integration and protein levels?

Several techniques have proven effective for studying PrrB membrane integration and expression levels:

  • Western blotting with anti-His antibodies: When PrrB contains a histidine tag, Western blotting using anti-His antibodies can detect and quantify the protein in membrane fractions. This approach has been used to confirm that mutant forms of PrrB (such as LP1-LP5 and TM1Δ) are properly integrated into the membrane .

  • Membrane fractionation: Isolating membrane fractions through ultracentrifugation techniques allows researchers to separate membrane-associated PrrB from cytosolic proteins, confirming proper localization.

  • Growth conditions standardization: For reliable comparisons between strains, researchers should grow cultures under standardized conditions (e.g., dark anaerobic conditions with DMSO as terminal electron acceptor, or aerobic conditions with 30% O₂) to an optical density at 600 nm of 0.4 to 0.5 .

The quality of membrane preparation is critical, as variations in protein extraction efficiency can lead to misinterpretation of results. For instance, lower levels of LP2 and LP3 mutant proteins observed in membrane fractions may reflect extraction difficulties rather than actual expression differences .

What approaches can be used to measure PrrB-dependent photosynthesis gene expression?

Several complementary approaches can be used to measure PrrB-dependent photosynthesis gene expression:

  • Spectrophotometric quantification of light-harvesting complexes: The abundance of B875 and B800-850 light-harvesting complexes can be measured spectrophotometrically and expressed in nmol/mg of membrane protein. This provides a direct measure of photosynthesis gene expression at the protein level .

  • Reporter gene assays: Fusing promoters of PrrB-regulated genes (such as the puf operon) to reporter genes like lacZ allows quantitative measurement of gene expression through enzyme activity assays. This approach reveals transcriptional regulation directly .

  • Growth phenotype analysis: Strains with altered PrrB function often show distinctive growth phenotypes under different oxygen conditions. For example, mutants with highly derepressed photosynthesis gene expression under aerobic conditions may form variegated colonies and show retarded growth .

A comprehensive approach combining these methods provides the most reliable assessment of PrrB function, as shown in this data from various PrrB mutants:

StrainB875 (30% O₂)B800-850 (30% O₂)puf Promoter Activity (30% O₂)B875 (Dark-DMSO)B800-850 (Dark-DMSO)
PrrB1 + pRK4150.40.532 ± 30.91.5
PrrB1 + pPRRB42.02.435 ± 24.110.4
LP18.715.585 ± 84.010.5
LP27.314.280 ± 124.29.8
LP49.513.0128 ± 153.910.0
LP57.912.875 ± 104.09.9
TM1Δ8.513.290 ± 124.39.5

Values for B875 and B800-850 are in nmol/mg protein .

How should researchers design mutations to study PrrB function?

When designing mutations to study PrrB function, researchers should consider:

  • Targeted approach based on topology: Understanding the membrane topology of PrrB is essential. Previous research has established that PrrB contains six transmembrane helices with three periplasmic and two cytoplasmic loops. Mutations should be designed based on this topology to target specific functional domains .

  • Types of mutations to consider:

    • Alanine insertions (as used in mutants LP1-LP5): These can disrupt the structure while minimizing side effects from bulky residues

    • Deletion mutations (as in TM1Δ): These can remove entire segments to assess their necessity

    • Point mutations: Particularly in conserved residues like the leucine-rich repeat

    • Domain replacements: Swapping domains with analogous proteins to assess function

  • Control constructs: Always include appropriate controls such as:

    • Empty vector controls

    • Wild-type PrrB complementation constructs

    • Promoter-only constructs to control for transcriptional effects

  • Expression systems: Consider using both native promoters and heterologous promoters, as these can reveal different aspects of regulation. For example, the prrB gene shows different behavior when expressed from its own promoter versus a tetracycline resistance promoter .

How can researchers distinguish between direct and indirect effects of PrrB mutations?

Distinguishing direct from indirect effects of PrrB mutations requires multiple lines of evidence:

  • Compare multiple phenotypic outputs: Measure both immediate outputs (PrrA phosphorylation) and downstream effects (photosynthesis gene expression, spectral complex formation) to identify disconnects that might indicate indirect effects .

  • Use epistasis analysis: By creating double mutants with other components of the signaling pathway (e.g., cbb₃ oxidase or PrrC), researchers can determine whether the effects of PrrB mutations are dependent on these components .

  • In vitro reconstitution: Purified components can be used to reconstitute signaling events in vitro, allowing direct measurement of PrrB kinase and phosphatase activities without cellular complications.

  • Temporal analyses: Measuring the kinetics of responses can help separate direct effects (typically rapid) from indirect effects (typically delayed).

  • Consider pleiotropic effects on growth: Some mutations that strongly deregulate photosynthesis genes can cause growth defects, as seen with the LP3 mutant which could not grow under aerobic conditions. These growth effects can complicate interpretation of gene expression data .

What controls are necessary when analyzing PrrB function?

When analyzing PrrB function, several controls are essential:

  • Null mutant control: Include a complete PrrB knockout strain (e.g., PrrB1 with empty vector pRK415) to establish the baseline in the absence of PrrB function .

  • Complementation control: Include the null mutant complemented with wild-type PrrB (e.g., PrrB1 with pPRRB4) to confirm that phenotypes can be restored by the wild-type protein .

  • Protein expression control: Verify that mutant proteins are being expressed at levels comparable to wild-type using Western blotting or other quantitative protein assays .

  • Membrane integration control: Confirm that mutant proteins are properly integrated into the membrane fraction .

  • Multiple growth conditions: Test function under both aerobic and anaerobic conditions to assess oxygen responsiveness .

  • Multiple readouts: Measure both direct (e.g., protein phosphorylation) and indirect (e.g., spectral complex formation) outputs of PrrB function .

How can researchers interpret contradictory results from different PrrB mutants?

When faced with contradictory results from different PrrB mutants, researchers should consider:

  • Protein stability and expression levels: Some mutants may show reduced expression or stability, as observed with LP2 and LP4 under aerobic conditions. This could lead to underestimation of their effects .

  • Dimerization effects: Since histidine kinases function as homodimers, mutations might affect dimerization rather than sensing or catalytic activity directly. Fortunately, the mutations studied in the reference research did not appear to affect dimerization, as they all showed significantly more spectral complex formation than the negative control .

  • Conformational effects: Some mutations might lock PrrB in specific conformational states rather than eliminating function entirely. This appears to be the case with LP2 and LP4 mutants, which show constitutive photosynthesis gene expression regardless of oxygen levels .

  • Partial vs. complete effects: Different mutations may cause partial vs. complete loss of function. For example, the LP3 mutant was partially impaired in spectral complex formation under anaerobic conditions but still showed levels well above the negative control .

  • Integration with existing models: Results should be interpreted in the context of the current model of PrrB function, where its default state is kinase-dominant and inhibitory signals shift it toward phosphatase activity .

What is the significance of the leucine-rich repeat in PrrB signal transduction?

The leucine-rich repeat identified in the region encompassing transmembrane helix 3, periplasmic loop 2, and transmembrane helix 4 of PrrB contains conserved leucine residues at positions 88, 94, 97, 98, 100, 104, 110, and 113. This feature has significant implications for PrrB function:

  • Protein-protein interaction potential: Leucine-rich repeats are found in many proteins and frequently mediate protein-protein interactions. This suggests that PrrB may interact directly with other proteins in the signaling pathway, possibly PrrC or components of the cbb₃ oxidase complex .

  • Evolutionary conservation: This region shows strong conservation among PrrB homologs in different photosynthetic bacteria, suggesting functional importance maintained through evolutionary selection .

  • Structural implications: The leucine-rich pattern may create a specific structural motif necessary for proper signal reception and transduction through the membrane.

  • Research opportunities: This region presents an excellent target for further investigation through site-directed mutagenesis of individual leucine residues to determine their specific contributions to sensing and signaling functions .

How does the regulatory relationship between PrrB and the cbb₃ oxidase function at the molecular level?

The relationship between PrrB and the cbb₃ oxidase involves several molecular components and mechanisms:

  • Signal generation: The cbb₃ cytochrome c oxidase serves as an oxygen sensor. The volume of electron flow through this oxidase generates the signal that controls PrrB activity. Greater electron flow (under aerobic conditions) produces a stronger inhibitory signal that shifts PrrB toward phosphatase activity .

  • Signal transduction pathway: The inhibitory signal is likely transduced to PrrB via the PrrC membrane-spanning protein. A model of this pathway places PrrC between the cbb₃ oxidase and PrrB based on the observation that PrrC null mutants show increased photosynthesis gene expression under aerobic conditions despite normal cbb₃ oxidase activity .

  • Default state modulation: The inhibitory signal shifts PrrB from its default kinase-dominant state to a phosphatase-dominant state. In the absence of this signal (under low-oxygen conditions or in certain mutants), PrrB functions primarily as a kinase, leading to PrrA phosphorylation and activation of photosynthesis genes .

  • Sensing domain: The transmembrane domain of PrrB, particularly the region around periplasmic loop 2, appears to be critical for receiving and responding to this signal .

  • Future research directions: While the general pathway has been established, the precise molecular mechanisms of signal transfer from the cbb₃ oxidase through PrrC to PrrB remain to be elucidated through techniques such as protein-protein interaction studies, structural analysis, and targeted mutagenesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.