Recombinant Sensory rhodopsin (sop)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant sensory rhodopsins are produced by expressing genes such as SrSRI (from Salinibacter ruber) or HsSRI (from Halobacterium salinarum) in heterologous systems like Escherichia coli or Haloferax volcanii. These proteins function as dual phototaxis receptors:

  • Positive phototaxis: Attraction to orange-red light (580–600 nm) via ground-state activation .

  • Negative phototaxis: Repellent response to UV/blue light through photointermediate states .
    Their signal transduction involves interaction with transducer proteins (e.g., HtrI/HtrII), which relay light signals to flagellar motors via phosphorylation cascades .

Photocycle Dynamics

Recombinant SrSRI demonstrates a photocycle with distinct intermediates:

IntermediateAbsorption Max (nm)LifetimeFunction
K5902 μsInitial photoexcited state
L55050 μsEarly proton transfer
M4005 msSchiff base deprotonation
O61020 msSignaling state for phototaxis

This contrasts with HsSRI, where the M state persists longer (≈100 ms), enabling UV avoidance responses .

Signal Transduction Mechanism

  • Light activation induces conformational changes in Helix F, communicated to transducer proteins via transmembrane helix interactions .

  • SrSRI lacks constitutive proton-pumping activity but retains signaling capability when paired with chimeric transducers .

Expression Systems and Stability

  • Halobacterium salinarum: Traditional host for HsSRI, but protein instability in low-salt conditions limits experimental use .

  • Salinibacter ruber: SrSRI exhibits superior stability in dilute solutions (≤1 M NaCl), enabling spectroscopic studies without detergent stabilization .

  • Escherichia coli: Limited success due to improper folding; Pichia pastoris shows promise for high-yield production .

Machine Learning Classification

Recent SVM models classify sensory rhodopsins with 98.8% accuracy using amino acid composition (AAC) and dipeptide composition (DPC). Key metrics:

ParameterSensory RhodopsinBacteriorhodopsin
AAC Score0.920.85
DPC Score0.890.78
Specificity99.1%97.3%

This aids in annotating novel rhodopsins in genomic datasets .

Evolutionary Significance

  • Eubacterial origin: SrSRI represents a horizontal gene transfer from archaea, with 40% sequence divergence from HsSRI .

  • Functional divergence: Loss of ion-pumping activity in sensory rhodopsins correlates with transducer dependency .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we have in stock, we can accommodate specific format requests. Please include your requirement in the order notes, and we will fulfill it to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is preferred, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquotting the solution for storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquotting is recommended for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
sop; Sensory rhodopsin; SR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
full length protein
Species
Halorubrum sodomense
Target Names
sop
Target Protein Sequence
MTGAVTSAYWLAAVAFLIGVGITAALYAKLEGSRARTRLAALAVIPGFAGLSYVGMALGI GTVTVNGAELVGLRYVDWVVTTPLLVGFIGYNAGASRRAIAGVMIADALMIVFGAAAVVS GGTLKWALFGVSALFHVSLFAYLYVIFPGGIPDDPMQRGLFSLLKNHVGLLWLAYPFVWL MGPAGIGFTGAVGAALTYAFLDVLAKVPYVYFFYARRQAFIDVTDSRAAAKGDGPAVGGE APVATGDDAPTAAD
Uniprot No.

Target Background

Function
Sensory rhodopsin (sop) plays a crucial role in the regulation of phototaxis.
Protein Families
Archaeal/bacterial/fungal opsin family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are sensory rhodopsins and how do they differ from other rhodopsins?

Sensory rhodopsins (SRs) are photoreceptor proteins that regulate phototaxis in microorganisms, particularly archaea and some eubacteria. Unlike ion-pumping rhodopsins (bacteriorhodopsin, halorhodopsin, and proteorhodopsin) that transport ions across membranes, sensory rhodopsins function primarily as signaling molecules that relay light information to transducer proteins. The key distinguishing feature of sensory rhodopsins is their significantly slower photocycles compared to ion-pumping rhodopsins, which allows for the transient accumulation of signaling states that control flagellar motor rotation through phosphorylation cascades . This slower kinetics has been optimized for sensory function rather than ion transport efficiency.

What types of sensory rhodopsins have been identified and characterized?

Two main types of sensory rhodopsins have been well-characterized:

  • Sensory Rhodopsin I (SRI) - Functions as a dual receptor regulating both positive and negative phototaxis in haloarchaea. The ground state mediates positive phototaxis with an action maximum around 580 nm, while its photointermediate absorbing at 377 nm acts as a sensor for negative phototaxis .

  • Sensory Rhodopsin II (SRII) - Functions solely as a receptor for negative phototaxis with absorption maximum around 500 nm .

Additionally, SRI-like proteins have been discovered in the eubacterium Salinibacter ruber (SrSRI), which are the first examples of SRI genes identified outside the Archaea (apart from sensory proteorhodopsin from γ-proteobacteria) .

How do sensory rhodopsins transduce light signals to cellular responses?

Sensory rhodopsins transduce light signals through a complex molecular mechanism:

  • Light absorption by the retinal chromophore initiates photoisomerization from all-trans to 13-cis configuration.

  • This conformational change triggers a series of structural alterations in the protein.

  • These changes modulate interactions with transducer proteins (e.g., HtrI for SRI, HtrII for SRII).

  • Activated transducers bind to a cytoplasmic histidine kinase (CheA).

  • CheA phosphorylates a phosphoregulator (CheY).

  • Phosphorylated CheY binds to the flagellar motor switch, controlling swimming reversal probability .

This signaling pathway allows the organism to move toward favorable light conditions (positive phototaxis) or away from harmful light (negative phototaxis).

What expression systems are effective for producing recombinant sensory rhodopsins?

Both homologous and heterologous expression systems have been successfully used for recombinant sensory rhodopsin production:

  • Homologous expression in Halobacterium salinarum:

    • The sopI and sopII genes (encoding SRI and SRII respectively) can be cloned into vectors like pBPH-M under the control of the bop promoter .

    • For SRI, the bop leader sequence can be fused to the 5' end of sopI by PCR, with omission of the 3' 42 bp, which improves expression .

    • For SRII, omitting the last 42 bp can increase protein yield approximately 10-fold compared to full-length protein .

  • Heterologous expression in Escherichia coli:

    • SrSRI from Salinibacter ruber expresses well in E. coli, yielding approximately 5 mg/liter of culture .

    • This system allows for production of stable protein with all-trans retinal as a chromophore.

The choice of expression system depends on the specific research goals, with E. coli offering higher yields but potentially requiring additional optimization for proper folding and chromophore incorporation.

How can the stability of recombinant sensory rhodopsins be improved during purification?

Stability is a critical consideration when working with sensory rhodopsins, as some variants (particularly HsSRI) are notoriously unstable in dilute salt solutions and detergents. Several approaches can improve stability:

  • Selection of naturally stable variants:

    • SrSRI from Salinibacter ruber shows very high stability even in detergent micelles, making it an excellent alternative to the less stable HsSRI .

    • NpSRII from Natronomonas pharaonis is much more stable than HsSRII, especially in dilute salt solutions and detergents .

  • Buffer optimization:

    • Maintaining appropriate salt concentrations is crucial, especially for haloarchaeal proteins.

    • For purification of His-tagged proteins, Ni-nitrilotriacetic acid matrices can be used under conditions optimized for stability .

  • Protein engineering:

    • Truncation of C-terminal regions (e.g., omitting the last 42 bp of sopII) can improve expression and potentially stability .

    • Introduction of specific stabilizing mutations based on sequence analysis or structural data.

The superior stability of SrSRI makes it particularly valuable for structural and mechanistic studies that were previously challenging with less stable SRs.

What are the critical factors for successful reconstitution of functional recombinant sensory rhodopsins?

Successful reconstitution of functional sensory rhodopsins requires attention to several critical factors:

  • Chromophore incorporation:

    • Ensuring proper incorporation of all-trans retinal is essential for functionality.

    • The retinal binds to a conserved lysine residue (e.g., Lys-205 in SrSRI) via a Schiff base, which is stabilized by conserved aspartate residues (e.g., Asp-72 in SrSRI) .

  • Membrane environment:

    • Sensory rhodopsins are membrane proteins requiring appropriate lipid environments for proper folding and function.

    • Detergent selection is critical; some detergents may destabilize certain SR variants.

  • Transducer protein co-expression:

    • For studying signaling functions, co-expression with appropriate transducer proteins (HtrI for SRI, HtrII for SRII) may be necessary.

  • Conservation of key residues:

    • Functional reconstitution requires preservation of key amino acids involved in chromophore binding, Schiff base stabilization, and proton transfer.

    • His-166 is important for active site proton transfer and phototaxis signaling in HsSRI, though interestingly, this is replaced by tyrosine in one of the SRI-like proteins from S. ruber (SRU_2511) .

What spectroscopic methods are most informative for analyzing sensory rhodopsin photocycles?

Several spectroscopic techniques provide valuable insights into sensory rhodopsin photocycles:

  • Ultrafast pump/probe spectroscopy:

    • Enables resolution of primary photochemical events on femtosecond to picosecond timescales.

    • Has revealed that SRII exhibits fast decay of the excited electronic state (300-400 fs) and transition between red-shifted product states in 4-5 ps .

    • In contrast, SRI at pH 6.0 shows a dramatically slower, biexponential decay on the picosecond timescale (5 ps and 33 ps) .

  • UV-Vis absorption spectroscopy:

    • Allows monitoring of ground state and photointermediates.

    • Low-temperature UV-Vis spectra can trap photointermediates for detailed characterization .

    • SrSRI exhibits a longer absorption maximum (558 nm) compared to SRII (500 nm) .

  • Steady-state fluorescence spectroscopy:

    • SRI shows increased fluorescence quantum yield compared to other rhodopsins .

    • Provides information on excited state dynamics and environmental effects.

  • Flash photolysis:

    • Enables monitoring of photocycle kinetics over longer timescales.

    • Has been instrumental in characterizing the slower photocycles of sensory rhodopsins compared to ion-pumping rhodopsins .

These complementary techniques together provide a comprehensive understanding of the photochemical reactions driving sensory rhodopsin function.

How do mutations in key residues affect spectral tuning and signaling in sensory rhodopsins?

Mutations in key residues can dramatically affect both the spectral properties and signaling functions of sensory rhodopsins:

  • Counterion residues:

    • Mutations affecting the counterion to the protonated Schiff base can shift absorption maxima and alter photocycle kinetics.

    • The aspartate residue (e.g., Asp-72 in SrSRI) that stabilizes the Schiff base is critical for proper spectral tuning .

  • Proton transfer pathway:

    • His-166 in HsSRI is crucial for active site proton transfer and phototaxis signaling.

    • In SrSRI (SRU_2511), this histidine is replaced by tyrosine, potentially affecting the proton transfer mechanism .

  • Chromophore-protein interactions:

    • Mutations altering the retinal binding pocket can change the stereochemistry and dynamics of photoisomerization.

    • These changes can shift the balance between positive and negative phototaxis functions.

  • Transducer interaction sites:

    • Mutations at the interface between SR and its transducer can modify signal transmission efficiency.

    • Conservation analysis between SRI variants can help identify critical residues for transducer interaction.

Systematic mutagenesis studies of SrSRI are particularly promising due to its high stability, allowing new approaches to investigate the photosignaling process in the SRI-HtrI system .

What is known about the differential photochemistry of SRI and SRII that explains their distinct signaling functions?

The distinct signaling functions of SRI and SRII can be traced to fundamental differences in their photochemistry:

  • Absorption properties:

    • SRI absorbs in the orange part of the spectrum (maximum ~580 nm), while SRII absorbs blue light (maximum ~500 nm) .

    • SrSRI has an absorption maximum at 558 nm, closer to that of prototypic HsSRI .

  • Excited state dynamics:

    • SRII exhibits fast decay of the excited electronic state (300-400 fs) similar to bacteriorhodopsin.

    • SRI shows dramatically slower decay with a biexponential profile (5 ps and 33 ps) .

    • These differences likely relate to the charge distribution in the retinal binding pocket.

  • Photocycle intermediates:

    • SRI functions as a dual receptor: its ground state mediates positive phototaxis, while its photointermediate (absorbing at 377 nm) triggers negative phototaxis .

    • SRII functions solely as a negative phototaxis receptor.

  • Photocycle kinetics:

    • Both SRI and SRII have slower photocycles compared to ion-pumping rhodopsins, allowing accumulation of signaling states.

    • This slower kinetics is crucial for sustained phosphorylation cascades controlling flagellar motor rotation .

The dual functionality of SRI makes it particularly interesting from a signaling perspective, as the same protein can trigger opposite cellular responses depending on its photochemical state.

How can recombinant sensory rhodopsins be employed in optogenetic applications?

Recombinant sensory rhodopsins offer several promising applications in optogenetics:

  • Light-controlled gene expression systems:

    • The photosensing domains of SRs can be fused to transcription factors to create light-responsive gene regulators.

    • The spectral diversity of different SR variants (SRI vs. SRII) allows for multiplexed control using different wavelengths.

  • Cell signaling modulation:

    • SR-based optogenetic tools can be designed to interface with second messenger systems.

    • The well-characterized signal relay mechanism involving histidine kinases and phosphoregulators can be adapted to control various cellular processes.

  • Advantages of SR-based systems:

    • The high stability of SrSRI makes it particularly suitable for optogenetic applications requiring robust performance.

    • The ability to express SrSRI in E. coli (5 mg/liter culture) facilitates efficient production of optogenetic constructs .

    • The slower photocycle kinetics of SRs can provide sustained signaling outputs following brief light stimulation.

  • Design considerations:

    • Modular fusion strategies can connect SR photosensory domains to various effector domains.

    • Mutations can be introduced to optimize spectral properties, kinetics, and coupling efficiency.

    • The established expression systems for recombinant SRs provide a foundation for developing optimized optogenetic tools.

What considerations should guide the design of experiments investigating SR-transducer protein interactions?

Investigating SR-transducer protein interactions requires careful experimental design:

  • Expression strategies:

    • Co-expression of SR with its cognate transducer (e.g., SRI with HtrI, SRII with HtrII) is often necessary to study physiologically relevant interactions.

    • The proper stoichiometry between receptor and transducer should be maintained.

  • Protein stability:

    • The relative instability of HsSRI has limited detailed study of SRI-HtrI interactions.

    • SrSRI's high stability even in detergent micelles offers new opportunities to investigate these interactions .

  • Structural considerations:

    • The signal relay mechanism involves changes in protein-protein interactions between SR and its transducer.

    • The transmembrane domains and cytoplasmic extensions of both proteins are important for signaling.

  • Functional assays:

    • Monitoring CheA kinase activity downstream of the SR-transducer complex provides a readout of signaling.

    • Behavioral assays measuring phototactic responses can complement biochemical approaches.

  • Comparative approaches:

    • Comparing interactions between different SR-transducer pairs (e.g., SRI-HtrI vs. SRII-HtrII) can reveal principles of signaling specificity.

    • The established signal relay mechanism of SRII-HtrII can serve as a reference for investigating the less well-characterized SRI-HtrI system .

What are the current challenges and future directions in sensory rhodopsin research?

Several challenges and promising future directions exist in sensory rhodopsin research:

  • Structural elucidation:

    • Obtaining high-resolution structures of SR-transducer complexes in different photocycle states remains challenging.

    • The discovery of SrSRI with its enhanced stability presents new opportunities for structural studies .

  • Signal transduction mechanisms:

    • The precise molecular mechanisms of positive vs. negative phototaxis signaling through SRI are not fully understood.

    • Detailed investigations of structural changes during the photocycle and their impact on transducer activation are needed.

  • Evolutionary perspective:

    • The identification of SRI homologs in eubacteria like S. ruber opens new questions about the evolution of photosensory systems across domains of life .

    • Comparative analyses of archaeal and bacterial SRs may reveal evolutionary adaptations in signaling mechanisms.

  • Biotechnological applications:

    • Developing SR-based biosensors and optogenetic tools with customized spectral and kinetic properties.

    • Exploiting the high stability and expression yields of SrSRI for biotechnological applications.

  • Systems-level understanding:

    • Integrating molecular mechanisms of SR signaling with systems-level models of phototactic behavior.

    • Understanding how multiple photoreceptors (SRI, SRII) coordinate to produce cohesive behavioral responses.

What NIH guidelines apply to research involving recombinant sensory rhodopsins?

Research involving recombinant sensory rhodopsins falls under the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules, with several key provisions:

  • Scope and applicability:

    • The guidelines apply to all institutions receiving NIH funding for any research involving recombinant or synthetic nucleic acids .

    • This includes the cloning and expression of genes encoding sensory rhodopsins like sopI and sopII.

  • Definition of covered molecules:

    • Recombinant nucleic acid molecules constructed by joining nucleic acid molecules that can replicate in a living cell.

    • Synthetic nucleic acids that are chemically synthesized or amplified and can base pair with naturally occurring nucleic acids .

    • Molecules resulting from the replication of those described above.

  • Exemptions relevant to SR research:

    • Synthetic nucleic acids may be exempt if they: cannot replicate in any living cell, are not designed to integrate into DNA, and do not produce lethal toxins .

    • Synthesis of nucleic acids that are solely the exact sequence of a non-chromosomal or viral DNA source that exists in a natural setting .

  • Registration requirements:

    • Research not meeting exemption criteria typically requires registration with institutional biosafety committees (e.g., Committee on Microbiological Safety, COMS) .

    • Consult with your Biosafety Officer (BSO) to determine whether your specific research with synthetic nucleic acids requires registration or is exempt .

How should researchers address potential biosafety concerns when working with engineered sensory rhodopsins?

When working with engineered sensory rhodopsins, researchers should address several biosafety considerations:

  • Risk assessment:

    • Evaluate whether modifications could potentially confer new properties that might affect the host organism's behavior or environmental interactions.

    • Consider whether engineered SRs might enhance survival or alter growth characteristics of host organisms.

  • Containment measures:

    • Follow appropriate biosafety level (BSL) practices based on risk assessment.

    • Standard recombinant DNA research with sensory rhodopsins typically falls under BSL-1 or BSL-2.

  • Host organism considerations:

    • Expression in laboratory strains of E. coli or H. salinarum generally presents minimal biosafety concerns.

    • Expression in new hosts should be evaluated for potential ecological impacts.

  • Synthetic nucleic acid guidelines:

    • For synthetic constructs, determine whether they meet exemption criteria or require registration under NIH guidelines .

    • Consider whether the synthetic nucleic acids have the potential to replicate, integrate into DNA, or be translated/transcribed .

  • Institutional oversight:

    • Consult with institutional biosafety committees before initiating work with novel engineered sensory rhodopsins.

    • Follow institutional procedures for registration and approval as required.

What strategies can resolve low expression yields of recombinant sensory rhodopsins?

When facing low expression yields of recombinant sensory rhodopsins, researchers can implement several optimization strategies:

  • Vector and promoter selection:

    • For expression in H. salinarum, the bop promoter has been successfully used to drive expression of sopI and sopII genes .

    • Consider using strong, inducible promoters appropriate for your expression host.

  • Sequence optimization:

    • Truncation strategies can significantly improve yields; omitting the last 42 bp of sopII increased protein amounts approximately 10-fold in H. salinarum .

    • For SRI, fusing the bop leader sequence to the 5' end of sopI can enhance expression .

  • Expression conditions:

    • Optimize temperature, induction timing, and duration.

    • For retinal-containing proteins, ensure sufficient availability of the chromophore during expression.

  • Host strain selection:

    • Consider using specialized expression strains designed for membrane protein production.

    • For heterologous expression, evaluate multiple host organisms; SrSRI expresses well in E. coli (5 mg/liter culture) .

  • Fusion tags:

    • C-terminal His tags have been successfully used for purification of recombinant SRs .

    • Consider fusion partners that may enhance folding or stability.

  • Solubilization and purification:

    • Optimize detergent selection for efficient extraction without compromising stability.

    • For His-tagged proteins, Ni-nitrilotriacetic acid matrices can be used for purification .

How can researchers distinguish between photochemical artifacts and genuine photointermediates in spectroscopic studies?

Distinguishing between photochemical artifacts and genuine photointermediates requires rigorous experimental controls and analyses:

  • Temperature-dependent measurements:

    • Low-temperature spectroscopy (e.g., 77K and 200K) can trap photointermediates and reduce thermal reactions .

    • Compare measurements at different temperatures to identify temperature-dependent spectral shifts.

  • Time-resolved spectroscopy:

    • Ultrafast pump/probe spectroscopy can resolve primary photochemical events on femtosecond to picosecond timescales .

    • The temporal evolution of spectral changes should follow consistent kinetic patterns for genuine photointermediates.

  • Differential spectroscopy:

    • Analyze difference spectra between light-activated and dark states to identify true light-induced changes .

    • Systematic analysis of wavelength-dependent photoactivation can help distinguish photochemical transitions.

  • Control experiments:

    • Perform parallel analyses on denatured or bleached samples to identify non-specific photochemical reactions.

    • Compare results with well-characterized rhodopsins (e.g., bacteriorhodopsin) as reference systems.

  • Correlation with functional data:

    • Genuine photointermediates should correlate with functional outcomes (e.g., transducer activation).

    • Mutagenesis of key residues should affect both spectral properties and functional responses.

This systematic approach helps ensure that observed spectral changes represent physiologically relevant photochemical transitions rather than experimental artifacts.

What methodological approaches can overcome challenges in studying unstable sensory rhodopsin variants?

Studying unstable sensory rhodopsin variants like HsSRI presents significant challenges that can be addressed through several methodological approaches:

  • Alternative stable homologs:

    • Use naturally stable homologs like SrSRI from Salinibacter ruber, which shows high stability even in detergent micelles .

    • NpSRII from Natronomonas pharaonis is more stable than HsSRII and can provide insights into sensory rhodopsin function .

  • Protein engineering:

    • Identify and mutate residues that contribute to instability based on sequence comparisons with stable homologs.

    • Create chimeric proteins incorporating stable regions from robust homologs.

  • Stabilization strategies:

    • Optimize buffer conditions, including salt concentration, pH, and additives.

    • Consider nanodiscs or amphipols as alternatives to detergent micelles for maintaining native-like membrane environments.

  • Rapid analysis techniques:

    • Employ methodologies that minimize the time between protein preparation and analysis.

    • Develop on-line purification and characterization workflows.

  • Computational approaches:

    • Use molecular dynamics simulations to study unstable variants virtually.

    • Apply homology modeling based on stable homologs to predict structural features.

  • Transient expression systems:

    • Develop in situ characterization methods that don't require extensive purification.

    • Consider cell-free expression systems that allow immediate functional analysis.

These complementary approaches can overcome the historical limitations in studying unstable sensory rhodopsin variants, particularly for investigating SRI-HtrI interactions and signal relay mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.