Recombinant Seoul virus Envelope glycoprotein (GP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GP; Envelopment polyprotein; M polyprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
647-1133
Protein Length
Full Length of Mature Protein
Species
Seoul virus (strain SR-11) (Sapporo rat virus)
Target Names
GP
Target Protein Sequence
AEIPLVPLWTDNAHGVGSVPMHTDLELDFSLPSSSKYTYKRHLTNPVNDQQSVSLHIEIE SQGIGAAVHHLGHWYDARLNLKTSFHCYGACTKYQYPWHTAKCHFEKDYEYENSWACNPP DCPGVGTGCTACGLYLDQLKPVGTAFKIISVRYSRKVCVQFGEEHLCKTIDMNDCFVTRH AKICIIGTVSKFSQGDTLLFLGPMEGGGIIFKHWCTSTCHFGDPGDVMGPKDKPFICPEF PGQFRKKCNFATTPVCEYDGNIISGYKKVLATIDSFQSFNTSNIHFTDERIEWRDPDGML RDHINIVISKDIDFENLAENPCKVGLQAANIEGAWGSGVGFTLTCKVSLTECPTFLTSIK ACDMAICYGAESVTLSRGQNTVKITGKGGHSGSSFKCCHGKECSSTGLQASAPHLDKVNG ISELENEKVYDDGAPECGITCWFKKSGEWVMGIINGNWVVLIVLCVLLLFSLILLSILCP VRKHKKS
Uniprot No.

Target Background

Function

Glycoproteins N and C, located on the virion surface, mediate attachment to host cell receptors, initiating virion internalization primarily through clathrin-dependent endocytosis. Following endocytosis, they facilitate fusion between the viral and host endosomal membranes. Glycoprotein N's ITAM motif may disrupt normal immune and endothelial cell responses, contributing to viral pathogenesis.

Protein Families
Hantavirus envelope glycoprotein family
Subcellular Location
[Glycoprotein N]: Virion membrane. Host Golgi apparatus membrane; Single-pass type I membrane protein. Host endoplasmic reticulum membrane; Single-pass type I membrane protein.; [Glycoprotein C]: Virion membrane. Host Golgi apparatus membrane; Single-pass type I membrane protein.

Q&A

What are the main envelope glycoproteins of Seoul virus and what are their primary functions?

Seoul virus possesses two primary transmembrane glycoproteins, designated Gn and Gc, which are derived from a single glycoprotein precursor through proteolytic cleavage during post-translational modifications. These glycoproteins interact with each other and are present on the surface of the virion. Functionally, they serve two critical roles: (1) attachment of the virion to cell receptors and (2) promotion of membrane fusion following endocytosis of the virion .

The roles are somewhat specialized, with Gn primarily involved in the viral attachment process while Gc is believed to drive the membrane fusion mechanism. This functional specialization is important when designing experimental approaches to study specific aspects of viral entry .

How do Gn and Gc interact with host cells to facilitate viral entry?

The entry of Seoul virus into human cells is primarily facilitated through the interaction of the viral surface glycoproteins with αvβ3 integrins present on the host cell surface. This interaction initiates the entry process, which proceeds through the following mechanism: first, the Gn glycoprotein mediates the initial attachment to cell surface receptors; following attachment, the virus particle undergoes endocytosis; finally, acidification of the endosomal compartment triggers conformational changes in the Gc protein that drive membrane fusion between the viral envelope and the endosomal membrane, releasing the viral genome into the cytoplasm .

Understanding this process is critical for developing intervention strategies that target specific steps in the viral entry pathway.

What expression systems are commonly used for producing recombinant Seoul virus glycoproteins?

Several expression systems have been successfully employed for producing recombinant Seoul virus glycoproteins, with the choice depending on research objectives:

  • E. coli cell-free expression system: Suitable for producing fragments of the envelope polyprotein with His-tag or tag-free configurations. This system is advantageous for high-throughput screening and rapid production but may not support all post-translational modifications .

  • Drosophila S2 expression system: This system has been utilized to enhance protein expression, solubility, and immunogenicity. The codon preference of Drosophila S2 cells can be employed to optimize glycoprotein consensus sequences. This approach is particularly valuable for vaccine development due to improved folding and glycosylation of the expressed proteins .

  • Mammalian cell expression systems: These provide the most native-like post-translational modifications and are often preferred for structural studies and functional assays.

Selection of the appropriate expression system should be guided by specific research needs, considering factors such as protein folding, glycosylation patterns, and required yield.

What optimization strategies improve the expression of soluble recombinant Seoul virus glycoproteins?

Several optimization strategies have demonstrated effectiveness in improving the expression of soluble recombinant Seoul virus glycoproteins:

Implementation of these strategies requires careful design of expression constructs and optimization of culture conditions specific to the chosen expression system.

What purification protocols yield the highest purity of recombinant Seoul virus glycoproteins?

High-purity recombinant Seoul virus glycoproteins can be obtained through a multi-step purification process that typically includes:

  • Initial clarification: Cell culture supernatants containing secreted glycoproteins should be centrifuged to remove cellular debris, followed by filtration through 0.45 μm filters.

  • Affinity chromatography: For His-tagged proteins, immobilized metal affinity chromatography (IMAC) using Ni-NTA or cobalt-based resins provides effective initial purification. Washing with buffers containing low concentrations of imidazole (10-20 mM) reduces non-specific binding before elution with higher imidazole concentrations (250-500 mM) .

  • Ion exchange chromatography: This can serve as a secondary purification step, separating proteins based on their charge properties.

  • Size exclusion chromatography: A final polishing step that separates proteins based on size and shape, effectively removing aggregates and providing buffer exchange.

The purification protocol should be validated by SDS-PAGE analysis, with purity levels >90% typically considered acceptable for most research applications . Western blotting using specific antibodies can confirm the identity of the purified glycoproteins.

How can researchers effectively assess the quality and functionality of purified recombinant Seoul virus glycoproteins?

Quality assessment of purified recombinant Seoul virus glycoproteins should include multiple complementary methods:

How do recombinant Seoul virus glycoproteins compare to inactivated virus vaccines in eliciting neutralizing antibodies?

Recombinant glycoprotein-based approaches have demonstrated several advantages over inactivated virus vaccines in eliciting neutralizing antibodies against Seoul virus. Comparative studies reveal:

  • Higher neutralizing antibody titers: Research has shown that recombinant glycoprotein delivery systems, such as pseudotyped lentiviruses expressing Seoul virus envelope glycoproteins, can induce significantly higher titers of neutralizing antibodies compared to traditional inactivated HFRS vaccines .

  • Improved cross-reactivity: Recombinant VSV-based vaccines expressing hantavirus glycoproteins have demonstrated enhanced cross-reactive neutralizing antibody responses against related viruses (including Seoul virus), exceeding the protection offered by multiple injections of inactivated vaccines .

  • Simplified immunization schedule: While inactivated vaccines typically require at least three injections spanning 6-12 months, recombinant approaches (particularly replication-competent vector-based systems) can provide robust protection after a single injection .

  • Duration of immunity: Single-dose recombinant VSV-based vaccines have established prolonged immunological memory with neutralizing antibodies persisting for over one year, providing long-term protection against infection .

These advantages make recombinant glycoprotein approaches particularly promising for developing next-generation vaccines against Seoul virus and related hantaviruses.

What are the most effective adjuvants for enhancing immunogenicity of recombinant Seoul virus glycoproteins?

When formulating vaccines based on recombinant Seoul virus glycoproteins, the selection of appropriate adjuvants can significantly enhance immunogenicity. Based on available research:

Importantly, the choice of adjuvant should be guided by the desired immune response profile, considering whether strong neutralizing antibody responses, balanced Th1/Th2 responses, or enhanced cellular immunity is the primary goal. Adjuvant selection may also influence dose requirements, dosing schedules, and the durability of the immune response.

What experimental models are most suitable for evaluating recombinant Seoul virus glycoprotein vaccines?

Several experimental models have been established for evaluating the efficacy and immunogenicity of recombinant Seoul virus glycoprotein vaccines:

  • Mouse models: BALB/c and C57BL/6 mice are commonly used to assess immunogenicity, with studies typically evaluating antibody responses, neutralizing antibody titers, and cellular immunity following immunization . The C57BL/6 model has been specifically validated for testing recombinant pseudotyped lentivirus vaccines expressing hantavirus envelope glycoproteins .

Mouse StrainApplicationsAdvantages
BALB/cImmunogenicity studies, challenge modelsWell-characterized immune responses, consistent results
C57BL/6Cellular immunity assessment, long-term studiesRobust T-cell responses, suitable for mechanistic studies
  • Challenge models: Following immunization, mice can be challenged with authentic Seoul virus to assess protection, evaluating parameters such as viral burden in tissues and inflammatory responses in target organs .

  • In vitro neutralization assays: These provide a quantitative measure of functional antibody responses without requiring animal challenge experiments.

  • Pseudotype virus assays: VSV or lentivirus pseudotyped with Seoul virus glycoproteins can be used in BSL-2 conditions to assess neutralizing antibody responses, offering a safer alternative to experiments with live virus.

When designing studies, researchers should consider endpoints relevant to clinical protection, including neutralizing antibody titers, viral load reduction, histopathological findings, and survival rates in challenge models.

How does the structure of Seoul virus Gc compare to other class II fusion proteins, and what implications does this have for vaccine design?

The structure of Seoul virus Gc shares significant similarities with other class II fusion proteins, with important implications for vaccine development:

  • Structural homology: Bioinformatic analyses and molecular modeling have demonstrated that Seoul virus Gc, like other hantavirus Gc proteins, exhibits remarkable structural similarity to the E1 protein of alphaviruses and the E protein of flaviviruses, which are established class II fusion proteins . This conservation exists despite limited sequence homology.

  • Domain organization: Seoul virus Gc likely contains the three canonical domains (I, II, and III) characteristic of class II fusion proteins, with domain II harboring the fusion peptide that inserts into target membranes during the fusion process .

  • Fusion mechanism: The structural similarities suggest a comparable fusion mechanism involving low pH-triggered conformational changes that expose the fusion peptide and drive the merging of viral and cellular membranes.

For vaccine design, these structural insights have several implications:

  • Stabilization of pre-fusion conformation: Knowledge of the conformational changes during fusion can guide the development of stabilized pre-fusion Gc constructs that better present neutralizing epitopes.

  • Targeting conserved fusion elements: The fusion peptide and surrounding regions represent functionally constrained domains that could serve as targets for broadly neutralizing antibodies.

  • Domain-focused immunogens: Designing immunogens based on specific domains (particularly domain III) might elicit antibodies that block key steps in the fusion process.

By leveraging these structural insights, researchers can design more effective Seoul virus glycoprotein immunogens that present critical neutralizing epitopes in their native conformations.

What strategies exist for improving the stability of recombinant Seoul virus glycoproteins for structural studies?

Several advanced strategies can enhance the stability of recombinant Seoul virus glycoproteins for structural studies:

Implementation of these strategies requires careful design and validation to ensure that the stabilized proteins retain native-like properties relevant to the research questions being addressed.

How can researchers identify conserved neutralizing epitopes across Seoul virus glycoprotein variants for universal vaccine development?

Identification of conserved neutralizing epitopes across Seoul virus glycoprotein variants requires a multi-faceted approach combining computational, structural, and immunological methods:

  • Sequence conservation analysis: Comprehensive alignment of glycoprotein sequences from diverse Seoul virus isolates can identify highly conserved regions that may represent functionally constrained domains . Particular attention should be paid to regions with >90% sequence identity across variants.

  • Structural mapping: Mapping conserved sequences onto predicted or experimentally determined structures can identify surface-exposed conserved regions that are likely candidates for neutralizing epitopes .

  • Epitope prediction algorithms: Computational tools can predict B-cell epitopes based on properties such as surface accessibility, hydrophilicity, and flexibility, prioritizing those that overlap with conserved regions.

  • Experimental epitope mapping: Techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) paired with neutralizing antibodies can experimentally identify binding epitopes.

  • Consensus sequence approach: Designing antigens based on consensus sequences that represent >50% conservation at each amino acid position has proven effective for developing broadly protective immunogens .

ApproachAdvantagesLimitations
Sequence conservationReadily applicable, computationally efficientMay miss conformational epitopes
Structural mappingIdentifies surface-exposed regionsRequires accurate structural models
Consensus designFocuses on predominant circulating variantsMay create artificial sequences
Experimental mappingDirectly identifies functional epitopesLabor-intensive, requires antibody panels

The combination of these approaches has successfully identified conserved regions within the envelope genes of circulating Hantaan and Seoul viruses, serving as the foundation for universal subunit protein vaccine designs .

What controls are essential when evaluating the immunogenicity of recombinant Seoul virus glycoproteins?

Rigorous experimental design for immunogenicity studies of recombinant Seoul virus glycoproteins should include several essential controls:

  • Negative controls:

    • Vehicle control (adjuvant only) to differentiate specific immune responses from adjuvant effects

    • Naïve mouse serum samples for establishing baseline values in serological assays

    • Irrelevant protein control (expressed and purified using the same system) to confirm specificity

  • Positive controls:

    • Inactivated Seoul virus vaccine as a benchmark comparator

    • Well-characterized monoclonal antibodies with known neutralizing activity for assay validation

  • Expression system controls:

    • Empty vector control lentivirus (e.g., rLV-ZsGreen) to account for vector-specific responses

    • Host cell protein contamination assessment to ensure observed responses are to the target protein

  • Assay controls:

    • P/N ratio calculation (comparing experimental wells to negative control wells), with values >2.1 typically considered positive for ELISA results

    • Isotype controls for flow cytometry analysis of cellular responses

    • Dose-response curves to establish the dynamic range of immunological assays

What are the key considerations when designing experiments to evaluate cross-protection against different hantavirus species?

Designing experiments to evaluate cross-protection against different hantavirus species requires careful consideration of several key factors:

  • Selection of challenge viruses: Include representative strains from phylogenetically distinct hantavirus species, particularly focusing on those with public health significance. For Seoul virus studies, cross-protection against Hantaan virus is particularly relevant given their co-circulation in many regions .

  • Virus quantification standardization: Ensure consistent virus quantification methods across different virus species to enable valid comparisons of protection levels.

  • Cross-reactivity assessment:

    • Compare neutralizing antibody titers against homologous versus heterologous viruses

    • Assess antibody binding to recombinant glycoproteins from different species using comparable assay conditions

    • Evaluate T-cell responses against conserved and variable epitopes

  • Challenge models:

    • Use standardized challenge doses across different virus species

    • Employ consistent routes of administration

    • Apply uniform endpoint criteria (viral load, pathology, survival)

  • Antigen design considerations:

    • Consensus sequence approaches may enhance cross-protection

    • Chimeric antigens incorporating epitopes from multiple species

    • Multivalent formulations containing antigens from different species

By systematically addressing these considerations, researchers can generate meaningful data regarding the breadth of protection elicited by Seoul virus glycoprotein-based vaccines or immunotherapeutics.

What methodologies are most suitable for studying the conformational changes of Seoul virus glycoproteins during viral entry?

Several advanced methodologies can effectively probe the conformational dynamics of Seoul virus glycoproteins during the viral entry process:

  • Structural biology approaches:

    • Cryo-electron microscopy of virions at different pH values to capture fusion intermediates

    • X-ray crystallography of glycoproteins in pre- and post-fusion conformations

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map regions experiencing conformational changes during the fusion process

  • Fluorescence-based techniques:

    • Förster Resonance Energy Transfer (FRET) between strategically placed fluorophores on glycoproteins to monitor distance changes during conformational shifts

    • Single-molecule fluorescence to track individual glycoprotein movements on the virion surface

    • Fluorescence microscopy of labeled virus particles during cell entry to correlate structural changes with specific entry steps

  • Functional assays:

    • pH-dependent membrane fusion assays using fluorescent lipid mixing

    • Site-directed mutagenesis of residues predicted to be involved in conformational changes, coupled with functional assessment

    • Fusion inhibition assays using conformation-specific antibodies or peptides

  • Computational approaches:

    • Molecular dynamics simulations to model conformational transitions

    • Normal mode analysis to identify flexible regions involved in structural rearrangements

    • In silico docking of inhibitors to identify potential fusion inhibitors

These complementary approaches can generate comprehensive insights into the complex structural rearrangements of Seoul virus glycoproteins that drive membrane fusion and viral entry, informing the development of entry inhibitors and vaccines.

How do genetic variations in Seoul virus envelope glycoproteins impact antigenicity and vaccine efficacy?

Genetic variations in Seoul virus envelope glycoproteins can significantly influence antigenicity and vaccine efficacy through several mechanisms:

To address these challenges, vaccine development strategies should:

  • Focus on conserved regions: Target vaccine designs toward highly conserved regions that experience purifying selection and are therefore less likely to tolerate mutations .

  • Use consensus sequences: Developing immunogens based on consensus sequences that represent >50% conservation at each amino acid position has proven effective for eliciting broadly protective responses .

  • Monitor circulating strains: Implement surveillance systems to track glycoprotein evolution in circulating viruses and assess potential impacts on vaccine efficacy.

  • Consider multivalent approaches: For regions with high variability, multivalent vaccines incorporating multiple variant antigens may provide broader protection.

Understanding the genetic diversity and evolutionary constraints of Seoul virus glycoproteins is fundamental to developing vaccines with durable and broad efficacy.

What techniques are most effective for monitoring the evolution of Seoul virus glycoproteins in natural reservoir populations?

Effective monitoring of Seoul virus glycoprotein evolution in natural reservoir populations requires a comprehensive approach combining field sampling, molecular techniques, and bioinformatic analyses:

  • Sampling strategies:

    • Longitudinal surveillance of defined rodent populations to track temporal changes

    • Geographically diverse sampling to capture spatial variation

    • Targeted sampling during outbreaks to identify potentially advantageous mutations

    • Non-invasive sampling methods (e.g., fecal samples) to increase sample sizes while minimizing impact on animal populations

  • Molecular methods:

    • Next-generation sequencing (NGS) for comprehensive characterization of viral populations

    • Targeted amplicon sequencing of envelope genes to achieve higher depth at lower cost

    • Metagenomic approaches to simultaneously detect co-infecting pathogens that might influence evolution

    • RT-PCR screening followed by Sanger sequencing for basic surveillance

  • Bioinformatic analyses:

    • Phylogenetic analysis to understand evolutionary relationships

    • Selection pressure analysis (dN/dS ratios) to identify sites under positive or purifying selection

    • Bayesian evolutionary analysis to estimate nucleotide substitution rates and divergence times

    • Network analysis to visualize transmission patterns within and between populations

  • Integration with other data:

    • Host population dynamics to correlate with viral genetic diversity

    • Ecological factors that might drive selective pressures

    • Human case data to identify variants associated with increased human infection

This integrated approach provides a comprehensive understanding of Seoul virus glycoprotein evolution, enabling early detection of emerging variants with altered antigenic properties or enhanced transmission potential .

How can researchers use evolutionary data to predict potential emergence of Seoul virus variants with altered glycoprotein properties?

Leveraging evolutionary data to predict the emergence of Seoul virus variants with altered glycoprotein properties involves several sophisticated analytical approaches:

  • Positive selection analysis: Identifying specific codons in glycoprotein genes under positive selection pressure (elevated dN/dS ratios) can highlight regions likely to accommodate adaptive mutations. These sites often correlate with epitopes targeted by neutralizing antibodies or regions involved in receptor binding .

  • Evolutionary rate assessment: Seoul virus has been characterized by high nucleotide substitution rates, which can accelerate adaptive evolution. Quantifying these rates in different genomic regions and under different ecological conditions can improve predictive models .

  • Phylodynamic modeling: Integrating genetic data with epidemiological information allows researchers to reconstruct viral population dynamics over time and project future evolutionary trajectories.

  • Deep mutational scanning: This experimental approach systematically assesses the functional impact of all possible single amino acid substitutions in glycoproteins, generating comprehensive mutation-effect maps that can predict viable evolutionary pathways.

  • Structural constraint analysis: Mapping sequence data onto protein structures can identify regions where mutations are likely to be tolerated without disrupting critical functions.

  • Ancestral sequence reconstruction: Reconstructing the evolutionary history of glycoprotein sequences can reveal historical patterns of adaptation that might predict future changes.

  • Mathematical modeling: Developing models that incorporate host population dynamics, immune pressure, and viral genetics can simulate evolution under different scenarios.

By integrating these approaches, researchers can identify potential evolutionary hotspots in Seoul virus glycoproteins and predict mutations likely to emerge under specific selective pressures, such as widespread vaccination or changing ecological conditions .

What are the most promising therapeutic approaches targeting Seoul virus glycoproteins for treating infections?

Several therapeutic approaches targeting Seoul virus glycoproteins show promise for treating infections:

  • Monoclonal antibodies (mAbs): Neutralizing antibodies targeting critical epitopes on Gn and Gc can block viral attachment and membrane fusion. Humanized or fully human mAbs with high neutralizing potency represent a leading therapeutic strategy, potentially administered as post-exposure prophylaxis or early treatment.

  • Peptide inhibitors: Peptides designed to mimic or bind to functional regions of the glycoproteins can interfere with viral entry. Specifically, peptides targeting the Gc fusion peptide or its interaction sites could prevent membrane fusion events critical for viral replication .

  • Small molecule entry inhibitors: Compounds that bind to pocket regions in the glycoproteins and stabilize pre-fusion conformations or otherwise prevent conformational changes required for fusion represent another promising approach.

  • Multivalent decoy receptors: Soluble forms of cellular receptors used by the virus (e.g., engineered αvβ3 integrin constructs) could potentially sequester virions and prevent cell attachment.

  • Glycoprotein-targeting antivirals: Small molecules designed to specifically bind to Seoul virus glycoproteins and interfere with their function through structure-based drug design approaches.

The most advanced approaches involve neutralizing antibodies and peptide inhibitors that can specifically block the viral entry process by interfering with glycoprotein functions . Development of these therapeutics requires detailed understanding of glycoprotein structure-function relationships and the mechanisms of viral entry.

How can high-throughput screening approaches be optimized for identifying inhibitors of Seoul virus glycoprotein functions?

Optimizing high-throughput screening (HTS) for Seoul virus glycoprotein inhibitors requires careful consideration of assay design, compound libraries, and validation strategies:

  • Assay development:

    • Pseudotype-based entry assays using lentiviral or VSV vectors bearing Seoul virus glycoproteins provide a safe, BSL-2 compatible system for screening entry inhibitors

    • FRET-based fusion assays can specifically target the membrane fusion function of Gc

    • Protein-protein interaction assays to identify compounds disrupting Gn-Gc interactions or glycoprotein-receptor binding

    • AlphaScreen or AlphaLISA approaches for detecting inhibitors of glycoprotein-receptor interactions

  • Compound library considerations:

    • Natural product libraries may yield peptide-like inhibitors targeting protein-protein interfaces

    • Fragment-based approaches can identify chemical starting points for structure-based optimization

    • Repurposing libraries of clinically approved drugs could accelerate development timelines

    • Focused libraries targeting viral fusion mechanisms may increase hit rates

  • Screening cascade optimization:

    • Primary screens at single concentrations (typically 10 μM) to identify initial hits

    • Dose-response confirmation in the primary assay format

    • Counter-screens against related and unrelated viruses to assess specificity

    • Cytotoxicity assays to eliminate generally toxic compounds

    • Secondary functional assays to confirm mechanism of action

  • Advanced validation approaches:

    • Time-of-addition studies to confirm the targeted entry step

    • Resistance selection studies to confirm glycoprotein targeting

    • Direct binding assays (SPR, ITC) to verify glycoprotein interactions

    • Structural studies of inhibitor-glycoprotein complexes to guide optimization

By implementing these strategies, researchers can establish robust screening cascades that efficiently identify and validate Seoul virus glycoprotein inhibitors with therapeutic potential.

What are the key structural determinants of Seoul virus glycoproteins that make good targets for therapeutic intervention?

Several structural features of Seoul virus glycoproteins represent promising targets for therapeutic intervention based on their functional importance and conservation:

  • Receptor binding sites: Regions of Gn involved in interactions with cellular receptors (particularly αvβ3 integrins) represent logical targets for inhibitors that could block the initial attachment step. These sites often form surface-exposed pockets suitable for small molecule or peptide binding .

  • Fusion peptide and surrounding regions: The fusion peptide within Gc, which inserts into target membranes during the fusion process, is typically highly conserved due to functional constraints. Compounds that bind to the fusion peptide or stabilize its pre-fusion conformation could prevent the conformational changes required for membrane fusion .

  • Gn-Gc interaction interfaces: The interfaces between Gn and Gc glycoproteins are critical for maintaining the metastable pre-fusion complex on the virion surface. Disrupting these interactions could prematurely trigger or inhibit the fusion machinery .

  • pH-sensing elements: Residues that sense endosomal acidification and trigger conformational changes in Gc represent another potential target. Compounds that interfere with this pH-sensing mechanism could prevent fusion activation.

  • Conserved hydrophobic pockets: Deep hydrophobic pockets within the glycoprotein structure that undergo conformational changes during the fusion process often make excellent small molecule binding sites.

Targeting these structurally and functionally critical elements offers the potential for developing interventions with high specificity and limited potential for resistance development due to evolutionary constraints on these regions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.