Recombinant Sepia officinalis Rhodopsin (RHO)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Sepia officinalis Rhodopsin (RHO) is a genetically engineered variant of the visual pigment rhodopsin derived from the common cuttlefish (Sepia officinalis). Rhodopsin, a G protein-coupled receptor (GPCR), is essential for phototransduction in cephalopod retinas, enabling vision under low-light conditions . The recombinant form is synthesized in heterologous expression systems (e.g., E. coli or mammalian cells) to study its structural, functional, and evolutionary properties.

Functional Properties

Recombinant Sepia rhodopsin retains photochemical activity critical for studying vision evolution and GPCR mechanisms:

  • Light Sensitivity: Ultrafast isomerization of 11-cis-retinal to all-trans-retinal initiates phototransduction .

  • G-Protein Interaction: Activates transducin-like G proteins in vitro, mimicking vertebrate phototransduction cascades .

  • Thermostability: Retains functional conformation under physiological temperatures, making it suitable for structural studies .

Evolutionary Studies

  • Spectral Diversity: Comparative analyses with squid (Loligo) and octopus (Paroctopus) rhodopsins reveal adaptive mutations for marine light environments .

  • Gene Expression: Embryonic studies show Sof-rhodopsin expression begins at stage 23, coinciding with functional photoreceptor maturation .

Biomedical Relevance

  • Disease Modeling: Misfolding mutants (e.g., P23H in humans) are studied to understand retinal degeneration mechanisms .

  • Therapeutic Development: Insights into GPCR stabilization inform pharmacological chaperone design for retinitis pigmentosa .

Production Challenges

Despite advances, recombinant production faces hurdles:

  • Chromophore Incorporation: Requires exogenous 11-cis-retinal supplementation for proper folding .

  • Membrane Localization: Achieving native-like membrane integration in bacterial systems remains inefficient .

Key Research Findings

Study FocusMethodologyOutcomeSource
Spectral TuningSite-directed mutagenesisIdentified A292S, A292G, and T194S as key residues for λ<sub>max</sub> shifts .
Developmental RoleIn situ hybridization in embryosSof-rhodopsin expression coincides with retinal pigment formation .
Cross-Species ActivityBovine-squid rhodopsin hybrid assaysDemonstrated conserved G-protein activation despite sequence divergence .

Future Directions

  • Optogenetic Tools: Engineering recombinant Sepia rhodopsin for light-sensitive ion channel applications.

  • High-Resolution Imaging: Cryo-EM studies to resolve activation mechanisms in marine GPCRs .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
RHO; Rhodopsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-464
Protein Length
full length protein
Species
Sepia officinalis (Common cuttlefish)
Target Names
RHO
Target Protein Sequence
MGRDIPDNETWWYNPTMEVHPHWKQFNQVPDAVYYSLGIFIGICGIIGCTGNGIVIYLFT KTKSLQTPANMFIINLAFSDFTFSLVNGFPLMTISCFIKKWVFGMAACKVYGFIGGIFGL MSIMTMSMISIDRYNVIGRPMAASKKMSHRRAFLMIIFVWMWSTLWSIGPIFGWGAYVLE GVLCNCSFDYITRDSATRSNIVCMYIFAFCFPILIIFFCYFNIVMAVSNHEKEMAAMAKR LNAKELRKAQAGASAEMKLAKISIVIVTQFLLSWSPYAVVALLAQFGPIEWVTPYAAQLP VMFAKASAIHNPLIYSVSHPKFREAIAENFPWIITCCQFDEKEVEDDKDAETEIPATEQS GGESADAAQMKEMMAMMQKMQQQQAAYPPQGAYPPQGGYPPQGYPPPPAQGGYPPQGYPP PPQGYPPAQGYPPQGYPPPQGAPPQGAPPQAAPPQGVDNQAYQA
Uniprot No.

Target Background

Function
Rhodopsin is a photoreceptor essential for image-forming vision under low light conditions. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change, activating signaling through G-proteins. Signaling mediates the activation of phospholipase C. Subsequent receptor phosphorylation leads to displacement of the bound G-protein alpha subunit by arrestin, terminating the signaling process.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of Sepia officinalis rhodopsin and how does it compare to other cephalopod rhodopsins?

Sepia officinalis rhodopsin is a G protein-coupled receptor (GPCR) characterized by seven transmembrane domains, which is consistent with the rhodopsin family of proteins. The protein contains several defining structural features including two conserved cysteines that form a disulfide bridge essential for GPCR stability, a lysine residue that serves as the chromophore/opsin binding site (equivalent to K296 in bovine rhodopsin), and the E/DRY motif along with NPXXY site that facilitate interaction with G proteins .

A distinctive characteristic of Sepia officinalis rhodopsin is its proline-rich C-terminus, which is a common feature across cephalopod rhodopsins. Unlike vertebrate opsins where a glutamate residue serves as the counterion, Sepia officinalis rhodopsin contains an aromatic amino acid at the equivalent position, a feature shared with all other invertebrate opsins studied to date .

Spectral analysis suggests that amino acid substitutions at just three sites may account for the spectral shifts observed between the rhodopsins of Sepia officinalis and other cephalopods including three species of squid and Paroctopus defleini, indicating a remarkably efficient spectral tuning mechanism .

When and where is rhodopsin expressed during Sepia officinalis embryonic development?

Rhodopsin expression in Sepia officinalis embryos begins at a specific developmental timepoint. According to in situ hybridization studies, Sof-rhodopsin expression is first detected in the developing retina at stage 23 of organogenesis and continues through hatching . The expression becomes more pronounced as development progresses through stages 25, 28, and 30, with significant increases in expression levels between these stages .

Transcriptomic analysis using FPKM (Fragments Per Kilobase Million) values confirms this developmental pattern. At stage 24, Sof-r-opsin1 shows detectable expression (FPKM values comparable to other light-sensitive molecules), while by stage 30, its expression dramatically increases to a mean FPKM of 3827, making it the most highly expressed of the light-sensitive genes in the developing eye .

RT-qPCR results further validate these findings, showing significant increases in Sof-r-opsin1 expression between stages 25 and 30, with the largest fold change occurring between stages 25 and 28 .

How does rhodopsin expression correlate with visual function in developing Sepia officinalis?

The correlation between rhodopsin expression and visual function in Sepia officinalis reveals important insights into the development of vision in cephalopods. Behavioral studies indicate that Sepia officinalis embryos begin to react to light stimuli from stage 25 of organogenesis, coinciding with the appearance of the first retinal pigments . This is significant because it correlates with the initial expression of rhodopsin, which begins at stage 23 and increases through development .

This developmental pattern correlates with the maturation of visual processing centers in the brain and optic lobes, indicating that complete visual function requires both high rhodopsin expression and fully developed neural circuitry for processing visual information .

What are the key genetic factors involved in rhodopsin regulation during Sepia officinalis eye development?

The genetic regulation of rhodopsin during Sepia officinalis eye development involves a complex interplay of developmental genes and transcription factors. Interestingly, the Retinal Determination Gene Network (RDGN) that controls eye morphogenesis in many metazoans, including genes like pax, six, eya, and dac, shows a divergent pattern in Sepia officinalis .

Studies have identified and characterized Sof-dac, Sof-six1/2, and Sof-eya in Sepia officinalis. While these genes are expressed in the eye area during early developmental stages, they are notably not expressed in the developing retina itself . This stands in contrast to Sof-otx, which is expressed in the retina from stage 19, well before rhodopsin expression begins at stage 23, suggesting a potential role in retinal differentiation and possibly upstream regulation of rhodopsin .

These findings highlight the unique aspects of the gene network controlling cephalopod retinal differentiation and rhodopsin expression, suggesting that cephalopods may have evolved distinctive regulatory mechanisms for photoreceptor development .

What spectral tuning mechanisms have been identified in Sepia officinalis rhodopsin compared to other cephalopods?

Research into spectral tuning of Sepia officinalis rhodopsin has revealed a remarkably efficient mechanism. Based on comparative sequence analysis with other cephalopod species, a model has been proposed suggesting that spectral shifts between the rhodopsins of Sepia officinalis, three species of squid, and Paroctopus defleini may be attributed to substitutions at only three amino acid sites .

This parsimony in the spectral tuning mechanism is significant for understanding how cephalopods have adapted their visual pigments to diverse oceanic photic environments. The specific amino acid positions involved in this tuning have been identified through sequence comparison and structure-function analysis, providing important insights into the molecular basis of wavelength sensitivity .

The identification of these key amino acid sites creates opportunities for site-directed mutagenesis experiments with recombinant rhodopsin to further elucidate the precise mechanisms of spectral tuning. Researchers working with recombinant Sepia officinalis rhodopsin can target these specific residues to experimentally validate their roles in spectral sensitivity and potentially engineer rhodopsins with modified spectral properties for optogenetic applications.

What is the diversity of light-sensing molecules in Sepia officinalis and how do they interact with rhodopsin?

Sepia officinalis possesses a diverse repertoire of light-sensing molecules beyond the classical rhodopsin. Transcriptomic analysis has identified 6 opsins, 2 cryptochromes, and 1 visual arrestin in Sepia officinalis . Among the opsins, three main types have been characterized: r-opsins (Sof_r-opsin1 and Sof_r-opsin2), retinochromes (Sof_reti1 and Sof_reti2), and xenopsins (Sof_xeno1 and Sof_xeno2) .

During embryonic development, not all these light-sensing molecules are expressed simultaneously or at the same levels. At stage 24, only Sof_r-opsin1, Sof_reti1, and Sof_reti2 show significant expression in embryonic eyes. By stage 30, these three opsins show dramatically increased expression, with Sof_r-opsin1 reaching the highest levels (mean FPKM = 3827), followed by Sof_reti1 (mean FPKM = 352) and Sof_reti2 (mean FPKM = 160) .

The cryptochromes (Sof_CRY 123 and Sof_CRY 6) are also expressed in both stages but at lower levels compared to the opsins. The visual arrestin (Sof_v-arr) shows significant expression and increases between stages 24 and 30 (reaching mean FPKM = 258), suggesting its important role in rhodopsin signaling regulation .

This data is summarized in the table below:

Light-sensing moleculeStage 24 (FPKM)Stage 30 (FPKM)Fold change
Sof_r-opsin1~283827~136×
Sof_reti1~28352~12.6×
Sof_reti2~28160~5.7×
Sof_v-arr~6.8258~38×
Sof_CRY 123~21~21~1×
Sof_CRY 6~12~12~1×
Sof_β-arr~12~12~1×

RT-qPCR analysis confirms these expression patterns and additionally shows that the largest increases in expression for Sof_r-opsin1, Sof_reti1, Sof_reti2, and Sof_v-arr occur between stages 25 and 28, highlighting a critical period in visual system development .

What methodological considerations are critical when expressing and purifying recombinant Sepia officinalis rhodopsin?

When expressing and purifying recombinant Sepia officinalis rhodopsin, several methodological considerations are critical for successful outcomes:

Primer Design and Gene Amplification:
The selection of appropriate primers is crucial for successful amplification of the rhodopsin gene. Based on characterized sequences, specific primers such as Sof-rhodopsinF3 have been successfully used in previous studies . When designing primers, researchers should target conserved regions identified through sequence alignments while accounting for the unique proline-rich C-terminus characteristic of cephalopod rhodopsins .

Expression System Selection:
The choice of expression system significantly impacts the proper folding and function of recombinant rhodopsin. Considering the seven transmembrane domain structure of rhodopsin and its requirement for post-translational modifications, eukaryotic expression systems such as insect cells (Sf9, Sf21) or mammalian cells (HEK293, COS) are generally preferred over bacterial systems. These systems can better support the complex folding requirements of GPCRs and provide appropriate membrane environments.

Chromophore Reconstitution:
For functional studies, reconstitution with the appropriate chromophore is essential. The specific lysine residue that serves as the chromophore binding site (equivalent to K296 in bovine rhodopsin) must be accessible for proper chromophore attachment . Timing and conditions of chromophore addition need to be optimized to maximize functional protein yield.

Purification Strategy:
Due to its transmembrane nature, rhodopsin purification typically requires detergent solubilization. Selection of appropriate detergents that maintain protein stability while effectively solubilizing the protein from membranes is critical. Common approaches include affinity chromatography using epitope tags (His, FLAG) engineered into the recombinant protein, followed by size exclusion chromatography to enhance purity.

Functional Validation:
Spectroscopic analysis is essential to confirm that the recombinant rhodopsin is properly folded and functional. Absorption spectra should be measured to verify chromophore binding and to determine the λmax value, which can be compared with the predicted spectral properties based on the amino acid composition at the three key sites identified in the spectral tuning model .

How do structural differences between Sepia officinalis rhodopsin and vertebrate rhodopsins impact biochemical and biophysical studies?

Structural differences between Sepia officinalis rhodopsin and vertebrate rhodopsins present significant implications for biochemical and biophysical studies:

Counterion Position:
In vertebrate rhodopsins, a glutamate residue (E113 in bovine rhodopsin) serves as the counterion to the protonated Schiff base linking the chromophore to opsin. In contrast, Sepia officinalis rhodopsin, like all invertebrate opsins studied so far, has an aromatic amino acid at this position . This fundamental difference affects the electrostatic environment around the chromophore, potentially altering the mechanisms of spectral tuning and photoactivation. Researchers must account for this when interpreting spectroscopic data and designing mutagenesis studies.

Proline-rich C-terminus:
Sepia officinalis rhodopsin contains a proline-rich C-terminus that is characteristic of cephalopod rhodopsins . This structural feature likely influences protein-protein interactions and possibly impacts the kinetics of rhodopsin signaling. When designing constructs for recombinant expression, decisions about whether to retain, modify, or replace this region can significantly affect protein behavior in functional assays.

G-protein Coupling Domains:
While both vertebrate and invertebrate rhodopsins contain conserved motifs for G-protein interaction (such as the E/DRY motif), subtle differences in these regions may lead to distinct signaling properties. The NPXXY site involved in G-protein interaction is not conserved across all Sepia officinalis opsin sequences , suggesting potential diversity in signaling mechanisms. This has implications for designing cell-based assays to study rhodopsin activation and downstream signaling.

Membrane Environment Requirements:
The structural differences likely correlate with different optimal membrane environments. When conducting reconstitution experiments or designing membrane mimetics for structural studies, researchers should consider that conditions optimized for vertebrate rhodopsins may not be ideal for Sepia officinalis rhodopsin. The lipid composition may need to be adjusted to better reflect the native membrane environment of cephalopod photoreceptors.

Protein Stability Considerations:
The unique structural features of Sepia officinalis rhodopsin may confer different stability properties compared to vertebrate rhodopsins. Temperature sensitivity, pH optima, and tolerance to detergents may differ significantly. Stability assays and storage conditions should be specifically optimized for the cephalopod protein rather than adopting protocols developed for vertebrate rhodopsins.

What evolutionary insights can be gained from studying rhodopsin diversity in cephalopods including Sepia officinalis?

The study of rhodopsin diversity in cephalopods offers valuable evolutionary insights into photoreceptor adaptation and convergent evolution:

Adaptation to Diverse Photic Environments:
Cephalopods occupy a wide range of oceanic photic environments, making them ideal subjects for studying visual adaptation. The spectral tuning model involving just three amino acid substitutions in Sepia officinalis rhodopsin compared to other cephalopods demonstrates a remarkably efficient mechanism for adaptation to different light environments . This parsimony in spectral tuning reveals how selective pressures can drive precise molecular changes with significant functional consequences.

Gene Structure Evolution:
The rhodopsin gene in Sepia officinalis contains an intron that splits codon 107, which contrasts with the intronless rhodopsin gene found in two species of myopsid squid . This difference in gene structure suggests dynamic evolutionary changes in gene organization within cephalopods and raises questions about the functional significance of intron presence or absence in rhodopsin genes.

Developmental Network Evolution:
The gene network controlling eye and retina development in Sepia officinalis shows interesting divergences from other metazoans. While the Retinal Determination Gene Network (RDGN) genes (Sof-six1/2, Sof-eya, and Sof-dac) are expressed in the eye area, they are absent from the retina itself, unlike in many other animals . This suggests that the genetic network controlling photoreceptor development has undergone significant evolutionary modifications in cephalopods, possibly related to the unique characteristics of their rhabdomeric photoreceptors.

Opsin Diversity and Specialization:
The identification of 6 different opsins in Sepia officinalis (r-opsins, retinochromes, and xenopsins) points to significant diversification of photoreceptive mechanisms within cephalopods . The differential expression patterns of these opsins during development and across tissues suggests functional specialization that may reflect adaptation to different aspects of light detection beyond simple image formation.

What are the current challenges in studying the signaling cascade downstream of activated Sepia officinalis rhodopsin?

Research into the signaling cascade downstream of activated Sepia officinalis rhodopsin faces several significant challenges:

Limited Knowledge of G-protein Coupling Specificity:
While rhodopsin is known to function as a G protein-coupled receptor (GPCR), the specific G-protein subtype(s) that Sepia officinalis rhodopsin couples with has not been fully characterized. The search results indicate that Sepia officinalis rhodopsin is a Gq-coupled/rhabdomeric photoreceptor opsin , but detailed interaction studies are lacking. The presence of conserved G-protein interaction motifs like E/DRY suggests similar coupling mechanisms to other rhodopsins, but the NPXXY site is not conserved across all Sepia's opsin sequences , indicating potential differences in signaling pathways.

Integration with Cryptochromes:
The co-expression of cryptochromes (Sof_CRY 123 and Sof_CRY 6) alongside rhodopsin in the developing eye raises questions about potential interactions or complementary roles between these two light-sensing systems . Cryptochromes typically function in circadian rhythms or as potential magnetoreceptors in other species, but their specific function in cephalopod vision and possible crosstalk with rhodopsin signaling remains poorly understood.

Tissue-Specific Signaling Variations:
Rhodopsin transcript has been detected not only in the retina but also in the skin of adult Sepia officinalis , suggesting potential differences in downstream signaling depending on the cellular context. The signaling cascade in extraocular photoreceptors may differ from that in retinal photoreceptors, adding another layer of complexity to understanding rhodopsin function across different tissues.

Developmental Changes in Signaling Components:
The significant increases in rhodopsin expression between stages 25-30, with the largest changes occurring between stages 25-28 , suggest that the composition of signaling components may change throughout development. This temporal regulation makes it challenging to establish a single model of the signaling cascade that applies across all developmental stages.

Technical Limitations in Cephalopod Research:
The relative scarcity of molecular tools specifically optimized for cephalopod systems presents technical challenges. Many antibodies and pharmacological agents used to study GPCR signaling have been developed for mammalian systems and may have limited cross-reactivity or efficacy in cephalopod tissues. Additionally, genetic manipulation techniques to study signaling in vivo are less developed for cephalopods compared to traditional model organisms.

What are the optimal methods for isolating and characterizing native rhodopsin from Sepia officinalis retinal tissue?

Isolating and characterizing native rhodopsin from Sepia officinalis retinal tissue requires specialized approaches to preserve the protein's structural integrity and functionality:

Tissue Preparation and Homogenization:
When working with Sepia officinalis retinal tissue, dissection should be performed under dim red light to prevent rhodopsin bleaching. The retina should be carefully separated from the lens, optic lobe, and surrounding tissues . For embryonic studies, precise staging is critical, with stages 25-30 showing the highest rhodopsin expression levels . Tissue homogenization should be performed in a buffer containing protease inhibitors at 4°C, typically using gentle mechanical disruption methods such as Dounce homogenization to preserve membrane integrity.

Membrane Preparation:
Following homogenization, differential centrifugation can be used to isolate photoreceptor membranes containing rhodopsin. A typical protocol involves low-speed centrifugation (1,000-3,000 × g) to remove cellular debris, followed by high-speed centrifugation (20,000-100,000 × g) to pellet membrane fragments containing rhodopsin. Sucrose density gradient centrifugation can further purify photoreceptor membranes from other cellular components.

Solubilization and Purification:
For solubilizing membrane-bound rhodopsin, mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) are preferred to maintain protein stability and function. Detergent concentration should be optimized to effectively solubilize rhodopsin while minimizing denaturation. Purification can be achieved through affinity chromatography if antibodies against Sepia officinalis rhodopsin are available, or through conventional chromatographic techniques such as ion exchange and size exclusion chromatography.

Spectroscopic Characterization:
Absorption spectroscopy represents the primary method for functional characterization of purified rhodopsin. Native Sepia officinalis rhodopsin has specific spectral properties that reflect its adaptation to its oceanic environment. Measuring absorption spectra before and after photobleaching allows determination of the λmax and assessment of photochemical integrity. Additionally, circular dichroism spectroscopy can provide information about secondary structure and protein folding.

Protein Identification and Analysis:
Western blotting using antibodies against conserved regions of rhodopsin can confirm protein identity. For detailed protein characterization, mass spectrometry analysis following tryptic digestion can provide sequence confirmation and identify post-translational modifications. N-terminal sequencing can verify the intact protein and confirm proper processing of any signal peptides.

Functional Assays:
G-protein activation assays using isolated photoreceptor membranes or reconstituted systems can assess the functional capacity of purified rhodopsin. These assays typically measure GTP binding or GTPase activity of G-proteins upon rhodopsin activation by light. Alternatively, when working with recombinant systems, calcium mobilization assays can be used to monitor downstream signaling events following rhodopsin activation.

How can transgenic approaches be optimized for studying Sepia officinalis rhodopsin expression patterns in vivo?

Developing transgenic approaches for studying Sepia officinalis rhodopsin expression patterns in vivo requires careful consideration of several key methodological aspects:

Promoter Selection and Regulatory Elements:
Identifying and characterizing the native promoter and regulatory elements of the Sepia officinalis rhodopsin gene is crucial for recapitulating authentic expression patterns. Based on the temporal expression pattern observed during development (starting at stage 23 and increasing through stage 30) , isolating the regulatory regions that drive this specific developmental timing would be valuable. Additionally, the potential involvement of Sof-otx as an upstream regulator suggests that including Otx-responsive elements could be important for proper expression.

Reporter Gene Selection:
For visualizing rhodopsin expression patterns, fluorescent proteins with spectral properties distinct from endogenous visual pigments should be selected. Given the marine environment of Sepia officinalis, red fluorescent proteins (like mCherry or tdTomato) might be preferable as they are less likely to interfere with the animal's visual function or behavior. For quantitative analysis, luciferase reporters can provide sensitive readouts of promoter activity.

Delivery Methods:
The development of reliable techniques for introducing transgenes into Sepia officinalis embryos is a significant challenge. Microinjection into fertilized eggs, similar to methods used in other marine invertebrates, represents one potential approach. The timing of injection is critical and should target early cleavage stages before cellularization is complete. Alternative approaches might include electroporation of early embryos or the use of viral vectors with tropism for cephalopod tissues.

Integration Strategies:
To achieve stable transgene integration, transposon-based systems (such as Tol2 or PiggyBac) could be adapted for use in cephalopods. These systems have shown efficacy across diverse animal phyla. For more precise genetic modifications, CRISPR/Cas9-mediated homology-directed repair could be employed to insert reporter constructs directly into the endogenous rhodopsin locus, ensuring all regulatory elements are preserved.

Validation of Expression Patterns:
Transgenic expression patterns should be validated against endogenous rhodopsin expression using techniques such as in situ hybridization or immunohistochemistry. The temporal dynamics of reporter expression should match the significant increases observed between stages 25-30, with particularly dramatic changes between stages 25-28 . Spatial patterns should correspond to the developing retina where rhodopsin is normally expressed.

Experimental Controls:
Appropriate controls are essential when developing new transgenic methods. These should include "empty vector" controls to assess background expression, positive controls using ubiquitous promoters to confirm the efficacy of the delivery method, and negative controls using promoters known to drive expression in non-retinal tissues to confirm tissue specificity of the observed patterns.

Ethical and Regulatory Considerations:
As cephalopods are recognized for their cognitive abilities, experimental designs must adhere to ethical guidelines for cephalopod research. Additionally, as transgenic cephalopods would represent a novel organism, appropriate containment procedures must be established to prevent environmental release.

How do the spectral properties of Sepia officinalis rhodopsin compare with other marine species adapted to different depths?

The spectral properties of Sepia officinalis rhodopsin reflect specific adaptations to its coastal marine environment and provide valuable insights when compared with species from different oceanic depths:

Spectral Tuning Mechanisms:
In Sepia officinalis rhodopsin, spectral tuning appears to be controlled by substitutions at only three amino acid sites, as suggested by comparative analysis with other cephalopod species . This parsimonious mechanism contrasts with the more complex tuning observed in deep-sea fish, which often involve numerous substitutions throughout the rhodopsin molecule. The specific tuning sites identified in Sepia officinalis represent key positions where relatively minor amino acid changes can significantly shift wavelength sensitivity.

Adaptation to Coastal Waters:
As a primarily coastal species, Sepia officinalis inhabits relatively shallow waters where the available light spectrum is broader than in deep ocean environments. Consequently, its rhodopsin spectral sensitivity is likely optimized for this photic environment, which typically has greater penetration of green-blue wavelengths compared to the predominantly blue light that penetrates to greater depths. The λmax of Sepia officinalis rhodopsin reflects this adaptation, though precise measurements would need to be compared against depth distribution data.

Comparative Analysis with Deep-Sea Cephalopods:
Deep-sea cephalopods often show rhodopsin adaptations to maximize sensitivity to the limited blue light available at depth. A comparative analysis between Sepia officinalis and deep-sea cephalopod species would likely reveal systematic differences at the three key amino acid positions identified for spectral tuning . These differences would demonstrate how natural selection has optimized rhodopsin properties based on depth-specific light environments.

Evolutionary Convergence with Other Marine Taxa:
The spectral tuning of rhodopsins across marine taxa from similar depth ranges often shows evolutionary convergence despite different ancestral starting points. Comparing Sepia officinalis rhodopsin with rhodopsins from teleost fish, marine mammals, or other marine invertebrates inhabiting similar depths would likely reveal convergent adaptations at functionally equivalent sites, even if the specific amino acid positions differ due to structural differences between vertebrate and invertebrate opsins.

Developmental Considerations:
The high expression levels of rhodopsin observed in late-stage Sepia officinalis embryos (stages 25-30) suggest that spectral sensitivity is already optimized before hatching. This pre-adaptation ensures that newly hatched cuttlefish can immediately function in their specific light environment, which is particularly important for visually-guided behaviors such as predator avoidance and prey capture that are critical for survival.

What insights do the genetic and molecular characteristics of Sepia officinalis rhodopsin provide for understanding photoreceptor evolution?

The genetic and molecular characteristics of Sepia officinalis rhodopsin offer significant insights into photoreceptor evolution across metazoans:

Rhabdomeric Versus Ciliary Photoreceptor Evolution:
Sepia officinalis possesses rhabdomeric photoreceptors that express rhodopsin identified as a true Gq-coupled/rhabdomeric photoreceptor opsin . This contrasts with the ciliary photoreceptors found in vertebrates, highlighting the major dichotomy in photoreceptor types across animal phyla. The detailed characterization of Sepia officinalis rhodopsin provides evidence for the independent evolution of these two photoreceptor systems while allowing comparison of their functional similarities and differences.

Gene Structure Evolution:
The presence of an intron splitting codon 107 in the Sepia officinalis rhodopsin gene contrasts with the intronless rhodopsin genes found in two species of myopsid squid . This difference in gene structure within relatively closely related cephalopods suggests dynamic evolutionary changes in gene organization. The intron position could represent either an ancestral state that was lost in myopsid squids or an intron gain in the Sepia lineage, providing insights into the mechanisms of gene structure evolution.

Conservation of Key Functional Domains:
Despite the evolutionary distance between cephalopods and other metazoans, Sepia officinalis rhodopsin maintains conserved structural features typical of GPCRs, including seven transmembrane domains, the chromophore binding site (lysine equivalent to K296 in bovine rhodopsin), and G-protein interaction motifs like E/DRY . This conservation across vast evolutionary distances highlights the fundamental constraints on rhodopsin structure imposed by its basic photoreceptive function.

Lineage-Specific Adaptations:
Alongside conserved elements, Sepia officinalis rhodopsin shows lineage-specific adaptations, such as the proline-rich C-terminus characteristic of cephalopod rhodopsins . This specialization may reflect adaptation to specific requirements of the cephalopod visual system, such as unique protein-protein interactions or particular membrane environments. Understanding the functional significance of these adaptations provides insights into how basic photoreceptor mechanisms can be modified for specific ecological or physiological requirements.

Developmental Gene Network Evolution:
The expression patterns of eye development genes in Sepia officinalis reveal interesting evolutionary divergences. While the Retinal Determination Gene Network (RDGN) genes (Sof-pax6, Sof-six1/2, Sof-eya, Sof-dac) are expressed in the eye area, they are not detected in the retina itself . This contrasts with many other metazoans where these genes play direct roles in retinal development. This divergence suggests significant evolutionary plasticity in the regulatory networks controlling eye development and rhodopsin expression, highlighting how conserved developmental genes can be repurposed in different lineages.

What statistical approaches are most appropriate for analyzing rhodopsin expression data across developmental stages?

When analyzing rhodopsin expression data across developmental stages in Sepia officinalis, several statistical approaches should be considered to ensure robust and meaningful interpretation:

Normalization Methods for RT-qPCR Data:
For accurate quantification of rhodopsin expression using RT-qPCR, appropriate normalization with reference genes is essential. In previous studies with Sepia officinalis, β-actin and Ef1 have been successfully used as reference genes . When selecting reference genes, their stability across developmental stages should be validated using algorithms such as geNorm or NormFinder. For RNA-seq data, normalization methods such as FPKM (Fragments Per Kilobase Million) or RSEM have been employed to allow comparison between different developmental stages .

Statistical Tests for Differential Expression:
To determine significant changes in rhodopsin expression across developmental stages, one-way ANOVA followed by Tukey's multiple comparisons test has been effectively applied in previous studies . This approach is appropriate when comparing expression across multiple developmental stages (e.g., stages 23, 25, 28, and 30). For pairwise comparisons between consecutive stages, t-tests with appropriate correction for multiple testing (e.g., Bonferroni or Benjamini-Hochberg) can be employed. The significance threshold should be clearly defined (typically p < 0.05) .

Correlation Analysis with Visual Function:
To relate rhodopsin expression to the development of visual function, correlation analyses can be performed between expression levels and behavioral or physiological measures of visual capacity. Pearson or Spearman correlation coefficients can quantify relationships between rhodopsin expression levels and quantitative measures of light sensitivity or response at different developmental stages. This approach can help establish whether the dramatic increase in rhodopsin expression between stages 25-28 corresponds directly to enhanced visual capabilities.

Multivariate Analysis for Multiple Light-Sensing Molecules:
When analyzing the expression of multiple light-sensing molecules simultaneously (e.g., different opsins, cryptochromes, and arrestins) , multivariate approaches such as principal component analysis (PCA) or hierarchical clustering can reveal patterns of co-expression and potential functional relationships. These methods can identify groups of genes with similar expression profiles across developmental stages, potentially indicating coordinated regulation or functional association.

Significance Thresholds for RNA-Seq Data:
For transcriptomic studies, clear criteria for significant expression should be established. Previous work with Sepia officinalis considered expression significant when amplification occurred before the 28th cycle of RT-qPCR (Cq < 28), with other results regarded as non-significant . For RNA-Seq data, a minimum FPKM threshold (e.g., FPKM > 1) can be used to distinguish genuine expression from background noise.

How can researchers address potential discrepancies between gene expression data and protein-level rhodopsin function?

Researchers investigating Sepia officinalis rhodopsin face challenges when reconciling gene expression data with protein-level function. Several methodological approaches can help address potential discrepancies:

Integrated Transcriptomic and Proteomic Analysis:
While transcriptomic studies have revealed the expression patterns of rhodopsin mRNA in Sepia officinalis embryos , these may not directly correspond to functional protein levels due to post-transcriptional regulation. Integrating proteomic approaches such as targeted mass spectrometry or western blotting with transcriptomic data can provide a more complete picture. Quantitative comparison between mRNA and protein levels across developmental stages can identify discrepancies that might indicate post-transcriptional regulatory mechanisms.

Translational Efficiency Assessment:
Discrepancies between mRNA and protein levels may reflect differences in translational efficiency. Polysome profiling, which separates mRNAs based on their association with ribosomes, can determine if rhodopsin mRNA is actively translated at different developmental stages. This technique can reveal potential translational regulation that might explain temporal gaps between gene expression and functional protein.

Post-translational Modification Analysis:
Functional rhodopsin requires specific post-translational modifications, including proper folding and membrane insertion. Mass spectrometry-based approaches can identify and quantify these modifications across developmental stages. Particularly important is the verification of chromophore attachment to the conserved lysine residue , which is essential for photosensitivity. Discrepancies between gene expression and function could result from delayed or incomplete post-translational processing.

Protein Stability and Turnover Studies:
The functional pool of rhodopsin depends not only on synthesis rates but also on protein stability and turnover. Pulse-chase experiments using labeled amino acids can measure rhodopsin half-life in different developmental contexts. If protein stability changes across development, this could explain situations where functional rhodopsin levels do not directly correlate with gene expression patterns.

Subcellular Localization Analysis:
Immunohistochemistry or confocal microscopy with rhodopsin-specific antibodies can verify proper trafficking and localization of rhodopsin to photoreceptor membranes. Functional discrepancies might arise if rhodopsin is synthesized but not correctly localized to photosensitive structures. The timing of proper membrane insertion relative to gene expression can be particularly informative.

Functional Correlation Studies:
Direct measurement of photosensitivity through electrophysiological recordings or calcium imaging in developing retinal tissues can be correlated with both gene expression and protein levels. The observation that Sepia officinalis embryos begin responding to light at stage 25, when rhodopsin expression is detected but before complete differentiation of rhabdomeric photoreceptors , suggests that even low levels of functional rhodopsin may support basic photosensitivity. Quantitative correlation between rhodopsin protein levels and physiological responses can help establish minimum thresholds for functional effects.

What are the most promising applications of recombinant Sepia officinalis rhodopsin in optogenetics and biosensor development?

Recombinant Sepia officinalis rhodopsin offers several promising applications in optogenetics and biosensor development, leveraging its unique properties as an invertebrate photoreceptor:

Novel Optogenetic Actuators:
The rhabdomeric nature of Sepia officinalis rhodopsin, functioning as a Gq-coupled photoreceptor opsin , provides opportunities to develop optogenetic tools that modulate signaling pathways distinct from those targeted by traditional ciliary rhodopsin-based tools. By coupling to Gq-mediated pathways, recombinant Sepia officinalis rhodopsin could enable optical control of phospholipase C activation, IP3 production, and intracellular calcium release. This would expand the toolkit available for manipulating cellular signaling with light in neuroscience research and potentially in therapeutic applications.

Spectrally Tuned Variants:
The identification of just three amino acid sites responsible for spectral tuning between cephalopod rhodopsins creates an excellent foundation for engineering spectrally shifted variants through site-directed mutagenesis. These variants could be developed into a family of optogenetic tools with different activation wavelengths, allowing multiplexed optical control of different signaling pathways in the same cell or tissue. The relatively simple tuning mechanism makes this an attractive system for rational design of spectrally diverse tools.

Bistable Photosensors:
If Sepia officinalis rhodopsin exhibits bistable properties like some other invertebrate rhodopsins, this would make it particularly valuable for applications requiring sustained activation without continuous illumination. Bistable opsins can be switched between active and inactive states with different wavelengths of light, offering precise temporal control without phototoxicity concerns associated with prolonged illumination. This property would be especially valuable in long-term in vivo applications.

Environmental Biosensors:
The adaptation of Sepia officinalis rhodopsin to coastal marine environments makes it a potential candidate for developing biosensors for environmental monitoring of aquatic systems. By coupling the rhodopsin to reporter systems, sensors could be developed to detect specific light conditions, pollutants that affect opsin function, or changes in water properties that modify photoreception. The natural adaptation of this system to marine conditions may provide advantages over terrestrial-derived sensors for aquatic applications.

Structural Templates for Designer Photoreceptors:
The unique structural features of Sepia officinalis rhodopsin, including its proline-rich C-terminus and invertebrate-specific counterion arrangement, provide alternative structural templates for designing novel photoreceptor proteins. Using protein engineering approaches, chimeric or modified opsins could be developed that combine advantageous features from both vertebrate and invertebrate systems to create photoreceptors with novel properties for sensing and control applications.

High-Sensitivity Light Detection Systems:
The visual system of cephalopods is renowned for excellent performance in low-light conditions. If Sepia officinalis rhodopsin contributes to this sensitivity, recombinant versions could be developed into high-sensitivity photodetection systems for applications requiring detection of very low light levels, potentially even single-photon detection for quantum optics or ultra-sensitive analytical devices.

What genomic and proteomic approaches could advance our understanding of rhodopsin diversity and function in cephalopods?

Advanced genomic and proteomic approaches offer significant potential to enhance our understanding of rhodopsin diversity and function in cephalopods, including Sepia officinalis:

Comparative Genomics of Cephalopod Visual Systems:
Whole genome sequencing across diverse cephalopod species occupying different oceanic niches would enable comprehensive comparative genomic analysis of rhodopsin gene families. By comparing rhodopsin genes from Sepia officinalis with those from deep-sea, pelagic, and other benthic cephalopods, researchers could identify convergent adaptations to specific light environments. This approach would extend the current understanding of spectral tuning through three key amino acid positions to potentially reveal other adaptive mechanisms across the entire opsin gene family.

Single-Cell Transcriptomics of Retinal Development:
Single-cell RNA sequencing (scRNA-seq) of developing Sepia officinalis retina would provide unprecedented resolution of the gene expression dynamics during photoreceptor differentiation. This approach could resolve the current knowledge gap regarding the gene network controlling rhabdomeric photoreceptor differentiation by identifying transcription factors and co-regulators expressed in developing photoreceptor cells. Temporal profiling across developmental stages 23-30 would be particularly valuable given the dramatic increase in rhodopsin expression during this period .

Chromatin Immunoprecipitation Sequencing (ChIP-seq):
ChIP-seq studies targeting transcription factors such as Sof-otx, which is expressed in the retina before rhodopsin expression begins , could identify direct regulatory interactions controlling rhodopsin expression. This approach would help elucidate the transcriptional regulatory network governing rhodopsin expression during development and potentially identify enhancer elements responsible for the dramatic upregulation between stages 25-28 .

Comprehensive Proteomic Analysis of Photoreceptor Membranes:
Mass spectrometry-based proteomic analysis of isolated photoreceptor membranes from different developmental stages would identify the complete protein composition of the phototransduction machinery. This would reveal not only rhodopsin levels but also associated signaling proteins, providing insights into how the complete signaling complex assembles during development. Quantitative proteomics comparing different developmental stages would complement the existing transcriptomic data and potentially identify post-transcriptional regulatory mechanisms.

Post-translational Modification Mapping:
Mass spectrometry approaches specifically targeting post-translational modifications of rhodopsin would reveal how these modifications regulate rhodopsin function across development and in different tissues. Particular attention to phosphorylation sites would provide insights into the regulation of rhodopsin signaling, while glycosylation analysis could inform on protein trafficking and membrane insertion. This information is crucial for understanding the functional regulation of rhodopsin beyond gene expression control.

CRISPR-Based Functional Genomics:
Developing CRISPR/Cas9 gene editing capabilities for Sepia officinalis would enable functional validation of the roles of different opsins identified in transcriptomic studies . Creating targeted knockouts of specific opsin genes or introducing point mutations at the three key sites implicated in spectral tuning would provide direct evidence of their functional roles. This approach would be particularly valuable for understanding the functional significance of opsin diversity and the roles of different opsins in various tissues.

Spatial Proteomics Using Proximity Labeling:
Proximity labeling approaches such as BioID or APEX could be applied to identify proteins that physically interact with rhodopsin in native cephalopod photoreceptor cells. By expressing rhodopsin fused to a proximity labeling enzyme in developing retinal tissue, researchers could map the changing protein interaction network throughout development. This would reveal how the rhodopsin signaling complex assembles and potentially identify novel components specific to cephalopod visual systems.

What are common pitfalls in rhodopsin isolation and characterization experiments, and how can they be avoided?

Researchers working with Sepia officinalis rhodopsin face several common technical challenges during isolation and characterization experiments. Here are the major pitfalls and strategies to overcome them:

Light-Induced Degradation:
Rhodopsin is highly susceptible to photobleaching, which can compromise experimental results. To avoid this pitfall, all procedures involving rhodopsin isolation should be performed under dim red light (>650 nm) to minimize activation. Sample containers should be wrapped in aluminum foil during storage and transportation, and spectroscopic measurements should be designed to minimize exposure time. For long-term storage, samples should be kept in light-tight containers at -80°C.

Detergent-Induced Denaturation:
The membrane-embedded nature of rhodopsin necessitates detergent solubilization, but inappropriate detergent selection can lead to protein denaturation. To avoid this, mild non-ionic or zwitterionic detergents (such as DDM, LMNG, or CHAPS) should be used at the minimum concentration required for solubilization. Detergent screening should be performed to identify optimal conditions for Sepia officinalis rhodopsin specifically, as conditions optimized for vertebrate rhodopsins may not be directly transferable.

Chromophore Instability:
The binding between opsin and chromophore (retinal) is sensitive to pH and ionic conditions. Maintaining appropriate buffer conditions (typically pH 6.5-7.5) with physiologically relevant salt concentrations is crucial for preserving the rhodopsin-chromophore interaction. For recombinant expression, co-expression with retinal or addition of exogenous retinal during purification may be necessary to ensure proper chromophore incorporation.

Proteolytic Degradation:
The proline-rich C-terminus characteristic of cephalopod rhodopsins may be particularly susceptible to proteolytic degradation. To prevent this, a comprehensive protease inhibitor cocktail should be included in all buffers from tissue homogenization through purification. For recombinant protein, fusion tags can be strategically placed to monitor potential proteolysis, and samples should be regularly checked by SDS-PAGE or mass spectrometry to verify protein integrity.

Heterogeneous Glycosylation:
Variable glycosylation can complicate both expression and analysis of rhodopsin. For recombinant expression, selecting appropriate eukaryotic systems that provide cephalopod-like glycosylation patterns is important. Alternatively, introducing mutations to remove glycosylation sites or using enzymatic deglycosylation can produce more homogeneous samples for structural studies. When analyzing native rhodopsin, methods that can distinguish between glycoforms should be employed.

Antibody Cross-Reactivity Issues:
Commercially available antibodies against vertebrate rhodopsins may have limited cross-reactivity with Sepia officinalis rhodopsin due to evolutionary divergence. Developing specific antibodies against Sepia officinalis rhodopsin epitopes is advisable for immunodetection work. Alternatively, epitope tags can be introduced into recombinant constructs to facilitate detection and purification while avoiding cross-reactivity concerns.

Spectroscopic Interference:
Impurities from retinal tissue, particularly screening pigments, can interfere with spectroscopic characterization of rhodopsin. To minimize this, additional purification steps such as size exclusion chromatography should be employed to remove contaminants. Baseline corrections in spectroscopic measurements should account for potential scattering effects, and difference spectroscopy (measuring spectra before and after photobleaching) can help isolate the rhodopsin-specific signal.

Expression System Limitations:
Heterologous expression of cephalopod rhodopsin can be challenging due to its membrane protein nature and potential requirements for specific cellular machinery. Testing multiple expression systems (mammalian, insect, yeast) is advisable. Codon optimization for the expression host and inclusion of appropriate trafficking signals can improve expression levels. Small-scale expression trials should be conducted before scaling up to identify optimal conditions.

How can researchers effectively integrate findings from genomic, structural, and functional studies of Sepia officinalis rhodopsin?

Effective integration of findings from genomic, structural, and functional studies of Sepia officinalis rhodopsin requires strategic approaches to synthesize diverse data types:

Multi-scale Modeling Frameworks:
Developing computational frameworks that connect genomic sequence information to protein structure and function can provide integrative understanding. Starting with the rhodopsin gene sequence , homology modeling based on available GPCR structures can predict the three-dimensional structure. Molecular dynamics simulations incorporating the unique features of Sepia officinalis rhodopsin (such as the proline-rich C-terminus ) can then predict functional properties like conformational changes upon activation. These predictions should be validated against experimental functional data, creating an iterative refinement process.

Structure-Function Correlation Databases:
Creating specialized databases that link specific rhodopsin sequence variants to their structural features and functional properties can facilitate integration. For instance, documenting how the three amino acid positions identified in spectral tuning correlate with measured absorption spectra across cephalopod species would create a valuable resource for predicting spectral properties from sequence alone. This database could incorporate developmental expression data to add temporal dimensions to the structure-function relationships.

Integrated Experimental Pipelines:
Designing experimental workflows that systematically connect genomic, structural, and functional analyses on the same samples promotes direct integration. For example, tissue samples from specific developmental stages could be divided for parallel transcriptomic analysis (measuring rhodopsin expression), proteomic analysis (quantifying rhodopsin protein and post-translational modifications), and functional assays (measuring photosensitivity). This coordinated approach ensures that correlations between different data types reflect biological relationships rather than sample variability.

Machine Learning Approaches:
Machine learning algorithms can identify patterns and relationships across diverse data types that might not be apparent through conventional analysis. By training models on combined datasets of rhodopsin sequences, structural features, expression patterns, and functional properties, researchers can potentially discover novel relationships. For example, sequence features might be identified that predict not only spectral properties but also expression dynamics during development or protein stability characteristics.

Collaborative Visualization Tools:
Developing visualization tools that simultaneously represent genomic, structural, and functional data can aid in identifying relationships across these domains. For instance, interactive molecular viewers could display the rhodopsin structure with amino acids color-coded based on expression timing during development , conservation across cephalopods, or functional importance in spectral tuning . Such tools facilitate hypothesis generation by making cross-domain patterns visually apparent.

Systematic Mutagenesis Studies:
Strategic mutagenesis approaches can directly test hypotheses arising from integrated analysis. For example, if integrated analysis suggests that certain structural features explain the dramatic increase in rhodopsin expression between stages 25-28 , targeted mutations could test this hypothesis. Similarly, mutations at the three key spectral tuning sites could verify their predicted effects on absorption spectra. The results would strengthen the connections between sequence, structure, and function.

Temporal Integration Frameworks:
Developing frameworks that explicitly incorporate the temporal dimension of rhodopsin biology can integrate developmental data with structural and functional insights. Mapping the progressive changes in rhodopsin expression , protein accumulation, structural maturation, and functional capacity throughout development provides a dynamic view of how the various aspects of rhodopsin biology are coordinated. This temporal integration is particularly important for understanding the relationship between rhodopsin expression and the emergence of visual function at stage 25 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.