Recombinant Serpentine receptor class alpha-11 (sra-11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
sra-11; CBG20639; Serpentine receptor class alpha-11; Protein sra-11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
full length protein
Species
Caenorhabditis briggsae
Target Names
sra-11
Target Protein Sequence
MSSPDTPVCASPQQMEMYNSHFYTCALFFNLLIAFTSMTLIIMAIRKLLTESIINTSTRM FLIVGLLCCSLHQTAYIVLRVQVIFQILFKLDQPCKLYYKAYDCKYVTFSLVAGNTGMIF IQSAMTIDRILTTVFTNLWPKLKYWPGVILSSFMIGCNFTNVQFIFWNDPLTDYVPTCGQ FPPKSVGRFQKFLEIALYMSLAHMVINVIILYINVVQDRRQRLVSTHDQSQSFDVNQRFQ SRVALKSTQAIFFLSMSQFLSCFLYTIFTKLYLTLQPDMTPLQSGLTLALTYTTPYACIA IPSLIMVTLTFIRNQRHRSINALRSQTETGDQYMQKIKKIWDK
Uniprot No.

Target Background

Function

A G protein-coupled receptor essential for olfactory imprinting, a crucial process in odorant responses such as those elicited by benzaldehyde and isoamyl alcohol.

Database Links

KEGG: cbr:CBG20639

Protein Families
Nematode receptor-like protein sra family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are serpentine receptors and how is sra-11 classified within this family?

Serpentine receptors comprise a large family of membrane receptors distributed across diverse organisms including bacteria, fungi, plants, and all metazoans . These receptors are characterized by a conserved seven-transmembrane (7-TM) architecture, though they constitute a highly divergent family with members within each family sharing only about 25% amino acid sequence identity in the conserved transmembrane core region .

Serpentine receptor class alpha-11 (sra-11) belongs to the Class A subfamily of serpentine receptors. Class A serpentine receptors have been bioinformatically classified based on the length of their N-terminal domains . The classification system helps organize these receptors based on structural similarities despite low sequence homology across different receptor subfamilies.

What are the structural characteristics that define serpentine receptors like sra-11?

The defining structural feature of all serpentine receptors, including sra-11, is the central core domain consisting of seven transmembrane helices (TM-1 through TM-7) connected by three intracellular loops and three extracellular loops . This characteristic membrane topology is essential for their function as signal transduction mediators.

Computational analysis of serpentine receptors typically employs transmembrane prediction programs like TMHMM 2.0, which is considered a reliable predictor for genuine G-protein coupled receptors (GPCRs) . The detection of these transmembrane domains is a critical first step in identifying potential serpentine receptors from genomic data.

What are the recommended approaches for recombinant expression of serpentine receptors like sra-11?

For recombinant expression of serpentine receptors, researchers should consider several methodological aspects:

  • Expression System Selection: Mammalian expression systems often provide the most appropriate cellular environment for proper folding and post-translational modifications of serpentine receptors.

  • Construct Design: When designing expression constructs, consider including epitope tags that don't interfere with receptor function, and potentially fusion partners that enhance membrane targeting and expression levels.

  • Membrane Topology Verification: After expression, verify the predicted seven-transmembrane topology using techniques such as immunofluorescence with antibodies against epitope tags placed at different receptor domains.

  • Functional Validation: Establish functional assays relevant to the receptor class to confirm that the recombinant protein maintains its biological activity.

What experimental designs are most appropriate for studying serpentine receptor function?

When designing experiments to study serpentine receptor function, researchers should consider both in vitro and in vivo approaches:

Randomized Controlled Trials (RCTs): While traditional efficacy-oriented RCTs focus on treatment effectiveness, implementation-focused RCTs for receptor studies would examine the effects of specific receptor modulators or genetic manipulations . These studies typically feature randomization and controlled manipulation of the independent variable.

Single Subject Experimental Designs (SSEDs): For more detailed functional characterization, on-off-on (ABA) designs may be appropriate to establish causality between receptor activation and downstream effects .

Quasi-Experimental Approaches: In some cases, especially when studying receptor function in complex biological systems, designs such as interrupted time series (ITS) might be necessary to capture temporal effects of receptor modulation .

What are the major challenges in expressing functional recombinant serpentine receptors?

The expression of functional recombinant serpentine receptors presents several technical challenges:

  • Membrane Insertion: Ensuring proper insertion into the membrane with the correct topology.

  • Protein Folding: Achieving native-like folding of the seven transmembrane domains.

  • Post-translational Modifications: Obtaining appropriate post-translational modifications that may be essential for function.

  • Stability: Maintaining stability of the recombinant protein during purification and analysis.

To address these challenges, researchers often employ strategies such as:

  • Using expression systems that closely mimic the native cellular environment

  • Including stabilizing mutations or fusion partners

  • Optimizing buffer conditions and detergents for membrane protein handling

  • Employing nanodiscs or other membrane-mimetic systems for functional studies

How can researchers verify the correct membrane topology of recombinant sra-11?

Verification of the correct membrane topology is crucial for functional studies. Techniques include:

  • Protease Protection Assays: By exposing intact cells or membrane fractions to specific proteases, researchers can determine which portions of the receptor are accessible (extracellular) versus protected (intracellular).

  • Immunofluorescence Microscopy: Using antibodies against epitope tags strategically placed at different receptor domains to confirm their expected cellular localization.

  • Glycosylation Site Mapping: Introducing glycosylation sites at putative extracellular domains to verify their localization through glycosylation status.

  • Computational Validation: Using multiple prediction programs beyond TMHMM 2.0 to cross-validate the predicted topology, as relying on a single prediction algorithm may miss potential candidates .

What strategies are effective for identifying ligands for orphan serpentine receptors?

Identification of cognate ligands for orphan serpentine receptors remains a significant challenge in the field. Effective strategies include:

  • Reverse Pharmacology: This approach involves expressing the orphan receptor in a heterologous system and screening compound libraries for activators/inhibitors.

  • Bioinformatic Predictions: Phylogenetic relationships with receptors of known ligand specificity can guide targeted screening approaches.

  • Expression Pattern Analysis: Examining the temporal and spatial expression patterns of receptors can provide clues about potential ligands. For instance, receptors with 24-hour rhythmic expression patterns might interact with circadian-regulated ligands .

  • Cross-Linking Studies: Chemical cross-linking of potential ligands followed by mass spectrometry can identify receptor-ligand interactions.

The International Union of Basic and Clinical Pharmacology Committee on Receptor Nomenclature and Drug Classification (NC-IUPHAR) has established criteria for recommending the pairing of an orphan receptor with its cognate ligand, including the demonstration of specific, high-affinity binding and functional responses .

How should researchers approach functional validation of ligand-receptor interactions for sra-11?

Functional validation of ligand-receptor interactions requires multiple complementary approaches:

  • Binding Assays: Demonstrate specific, high-affinity binding using purified receptor or membrane fractions containing the receptor.

  • Signaling Assays: Measure downstream signaling events, such as G-protein activation, cAMP production, calcium mobilization, or β-arrestin recruitment.

  • Dose-Response Relationships: Establish concentration-dependent effects of the putative ligand.

  • Specificity Controls: Confirm that closely related receptors do not respond to the same ligand, or respond with different potency/efficacy.

  • Mutational Analysis: Identify key receptor residues involved in ligand binding and signaling by site-directed mutagenesis.

What are the recommended approaches for analyzing expression data of serpentine receptors?

When analyzing expression data for serpentine receptors, researchers should consider:

For example, in studies of Plasmodium falciparum, Real Time PCR has been used to detect the expression of serpentine receptor genes during intraerythrocytic stages, indicating their potential role in parasite development .

How should contradictory functional data for serpentine receptors be reconciled?

Reconciling contradictory functional data requires systematic evaluation:

  • Experimental Context: Consider differences in experimental systems (cell lines, expression levels, detection methods) that might explain discrepancies.

  • Receptor Splice Variants: Determine if different splice variants with potentially different functions are being studied.

  • Post-translational Modifications: Assess whether differential post-translational modifications might affect receptor function across studies.

  • Ligand Preparation: Evaluate differences in ligand preparation, purity, and concentration that might impact receptor activation.

  • Signaling Pathway Analysis: Consider that the same receptor might couple to different signaling pathways in different cellular contexts.

A systematic approach to analyzing contradictory data includes defining clear assumptions, selecting appropriate control groups, and performing sensitivity analyses to identify critical parameters .

How can serpentine receptor research inform understanding of parasite biology and potential therapeutic targets?

Research on serpentine receptors has significant implications for understanding parasite biology:

  • Developmental Regulation: In Plasmodium species, serpentine receptors like SR10 show 24-hour rhythmic expression, suggesting roles in regulating intra-erythrocytic development cycle (IDC) duration .

  • Signal Transduction: These receptors may mediate responses to host factors or environmental cues, potentially controlling key developmental transitions.

  • Therapeutic Targeting: As membrane proteins with specific ligand interactions, serpentine receptors represent potential drug targets for anti-parasitic therapies.

Studies have shown that disruption of certain serpentine receptors (like SR10) affects many of the same processes that are disrupted when coordination to host rhythms is perturbed in malaria parasites . This suggests these receptors may serve as central regulators of parasite development in response to host cues.

What scalability and replicability considerations should be addressed in serpentine receptor research?

When designing larger-scale studies of serpentine receptors, researchers should consider:

  • Scope Definition: Clearly define the dimensions of analysis, focusing on the most critical parameters affecting scalability and replicability .

  • Methodological Approach Selection: Define whether a qualitative, quantitative, or combined approach is most appropriate for each dimension of analysis .

  • Data Requirements: Early identification of required input data and potential data sources is essential to prevent delays in study execution .

  • Scenario Development: Define relevant scenarios that allow exploration of the receptor's function across different contexts and conditions .

  • Cross-Validation: Employ multiple methodological approaches to validate findings, particularly when working with highly divergent receptor families like serpentine receptors where sequence homology may be limited .

How does sra-11 compare to other serpentine receptor classes in terms of structure and function?

While specific comparison data for sra-11 is limited in the search results, general principles of serpentine receptor comparison include:

  • Structural Conservation: Despite low sequence similarity across different families, the seven-transmembrane architecture is conserved .

  • Ligand Binding Domains: Different receptor classes may have distinct ligand binding domains, with class A receptors typically binding ligands within the transmembrane domains.

  • N-Terminal Domain Length: Class A serpentine receptors like sra-11 are classified partly based on the length of their N-terminal domains .

  • Conservation Across Species: Some serpentine receptors, like SR10 and SR25 in Plasmodium species, are highly conserved across different species, while others like SR1 and SR12 show more divergence .

Table 1: Common Characteristics of Different Serpentine Receptor Classes

CharacteristicClass AClass BClass CClass F
N-terminal domainShort to mediumLongVery long (Venus flytrap)Medium
Ligand binding siteWithin TM bundleN-terminus + TM bundleN-terminusExtracellular domain
Common ligandsBiogenic amines, peptidesPeptide hormonesAmino acids, ionsWnts, proteins
G-protein couplingDiversePrimarily GsPrimarily Gi/GoLess characterized

What evolutionary insights can be gained from studying serpentine receptor families across species?

Evolutionary analysis of serpentine receptors provides several insights:

  • Functional Conservation vs. Sequence Divergence: Receptors with similar functions can have divergent sequences, while receptors with disparate evolutionary origins may bind and respond to the same ligands .

  • Phylogenetic Relationships: Analysis of receptor families across species can illuminate evolutionary adaptations to different environmental niches and physiological requirements.

  • Parasite-Host Coevolution: In parasites like Plasmodium, serpentine receptors may have evolved to detect and respond to host factors, representing key adaptation points in host-parasite coevolution.

  • Orphan Receptor Characterization: Evolutionary relationships can guide the identification of potential ligands for orphan receptors like GPR3, GPR6, and GPR12 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.