Recombinant Serpentine receptor class alpha-13 (sra-13)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Biological Systems

SRA-13 modulates critical signaling pathways:

  • Chemosensory regulation: Mediates olfactory responses to volatile attractants like benzaldehyde and isoamyl alcohol .

  • Developmental signaling:

    • Suppresses vulval induction under food starvation by inhibiting RAS/MAPK signaling .

    • Interacts with the GPA-5 G-alpha subunit to regulate downstream effectors .

Key phenotypes in C. elegans:

  • Loss of SRA-13 leads to aberrant vulva development and impaired odorant responses .

  • Required for starvation-induced suppression of RAS/MAPK activity .

Research Applications

Recombinant SRA-13 is utilized in:

  • Ligand-binding assays: Identifying chemosensory ligands via tagged protein interactions .

  • Signal transduction studies: Reconstituting GPCR pathways in vitro to dissect RAS/MAPK crosstalk .

  • Structural biology: Investigating transmembrane domain architecture using purified protein .

Comparative Insights from Related Serpentine Receptors

  • SRA-11: Shares 45% sequence homology with SRA-13 and regulates olfactory imprinting in C. elegans .

  • SRE-19: Another C. elegans GPCR linked to insulin signaling, highlighting functional diversity within the family .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
sra-13; F49E12.5; Serpentine receptor class alpha-13; Protein sra-13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
sra-13
Target Protein Sequence
MAIISSVNRTCASESLLELYRSYKYILSTSFNIIIPIISLFFLVYAIKQLCAQSIIQYST RVLLITTILFAVCHQIAYFCFKADLLYTMLFKLDQPCNLQHSSYDCRFITIATTTSNCGM ALVQLAMSIDRVFALKFNRVYYKLKSIPGITLALITLSISFSMFFILTIDDPLSGYVNHC GFYPTYSQDKFHIFLDVTLYLAVFNFVFDIGLMYYSYQEILWKRSYSFVNRFQSRISLKC TQAIFIISICQCISNVLYSGLLSLLMKLGRYMSSADYNLSLSLAYTTPYSCLILPILICK VLEYIKKQRTVGILSLRNQKQSMEGHMAMINSAWK
Uniprot No.

Target Background

Function

Function: Recombinant Serpentine receptor class alpha-13 (sra-13) is a chemosensory receptor that negatively regulates RAS/MAPK signaling during vulva induction and negatively regulates the olfaction of volatile attractants. It is essential for suppressing vulval induction in response to food starvation. Signaling occurs through the GPA-5 G-alpha protein subunit.

Database Links

KEGG: cel:CELE_F49E12.5

STRING: 6239.F49E12.5a

UniGene: Cel.15037

Protein Families
Nematode receptor-like protein sra family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the AWA and AWC chemosensory neurons.

Q&A

What is Serpentine receptor class alpha-13 (sra-13) and to which GPCR class does it belong?

Serpentine receptor class alpha-13 (sra-13) is a G protein-coupled receptor primarily studied in Caenorhabditis elegans that belongs to the Class A (rhodopsin-like) GPCR family. Class A represents the largest group of GPCRs, constituting over 80% of human GPCR subtypes, and includes receptors that mediate responses to neurotransmitters, hormones, and paracrine signals . The receptor features the characteristic seven-transmembrane domain structure common to all GPCRs, with an extracellular N-terminus and intracellular C-terminus. Despite the short N-terminal extracellular domain typical of Class A receptors, these receptors can form homo- and heterodimers, which may be relevant for sra-13 function .

How is recombinant sra-13 typically produced for research purposes?

Recombinant sra-13 production follows standard molecular cloning procedures adapted for membrane proteins. The process typically involves:

  • Amplification of the sra-13 gene sequence from C. elegans cDNA using PCR with specific primers

  • Cloning into an appropriate expression vector containing:

    • A strong promoter (e.g., CMV for mammalian cells)

    • An affinity tag (commonly His6 or FLAG) for purification

    • A signal sequence for proper membrane targeting

  • Transformation or transfection of the construct into an expression system

  • Expression optimization through temperature, induction time, and media adjustments

  • Membrane isolation followed by detergent solubilization

  • Affinity chromatography purification based on the incorporated tag

  • Verification of proper folding through ligand binding assays

For functional studies, researchers often use mammalian cell lines (HEK293, CHO) that can perform post-translational modifications. For structural studies requiring higher yields, insect cell expression systems (Sf9, High Five) may be preferred.

What signaling pathways are typically associated with sra-13 activation?

As a GPCR likely coupled to the G12/13 subfamily, sra-13 activation would initiate signaling cascades similar to other G12/13-coupled receptors. These signaling pathways include:

  • The Gα12/13-RH-RhoGEF-Rho pathway: Activated Gα13 directly stimulates the guanine nucleotide exchange factor (GEF) activity of RhoGEFs such as p115RhoGEF and LARG . This interaction leads to RhoA activation, which regulates cytoskeletal reorganization and cell morphology.

  • Regulation occurs through multiple interaction interfaces, including the RH domains and DH/PH domains of RhoGEFs with Gα13 . Surface plasmon resonance studies have demonstrated that simultaneous binding of these domains facilitates formation of high-affinity active Gα13-LARG complexes .

  • Cross-talk with other signaling pathways: Like many GPCRs coupling to G12/13, sra-13 likely interacts with multiple G protein subfamilies, particularly Gαq, complicating the analysis of specific signaling pathways .

What computational approaches can be used to predict functional characteristics of recombinant sra-13?

Several computational approaches can be employed to predict functional characteristics of recombinant sra-13:

  • SVM-Prot Feature Extraction: This approach transforms protein sequences into fixed-size vectors based on amino acid composition and physical-chemical properties. For sra-13, the 188D feature vectors can be generated following these steps:

    • Extract Pfam numbers from the UniProt database

    • Transform sequences into feature vectors based on amino acid properties

    • Apply machine learning classifiers like Random Forest

  • Homology Modeling and Molecular Dynamics:

    • Generate structural models using templates from related Class A GPCRs

    • Refine models through molecular dynamics simulations

    • Perform in silico docking to identify potential ligands

  • Classification Analysis: Based on the GPCR classification system, sra-13 can be analyzed within the context of Class A receptors and their specific signaling characteristics .

How can researchers investigate potential dimerization of sra-13 with other GPCRs?

Investigating sra-13 dimerization requires multiple complementary approaches:

  • Bioluminescence/Fluorescence Resonance Energy Transfer (BRET/FRET):

    • Tag sra-13 with a donor fluorophore (e.g., GFP)

    • Tag potential dimerization partners with acceptor fluorophores (e.g., YFP)

    • Co-express in appropriate cell lines

    • Measure energy transfer as evidence of protein proximity

  • Co-immunoprecipitation:

    • Express differentially tagged versions of sra-13 and potential partners

    • Immunoprecipitate using one tag

    • Detect co-precipitated proteins via western blotting

  • Cross-linking Studies:

    • Apply membrane-permeable cross-linking agents to intact cells

    • Isolate protein complexes

    • Analyze by SDS-PAGE and mass spectrometry

Given that Class A receptors like sra-13 can form homo- and heterodimers despite their short N-terminal extracellular domains , these approaches would provide valuable insights into the receptor's functional complexes.

What experimental approaches are most effective for studying the interaction between recombinant sra-13 and G12/13 proteins?

To study sra-13 interactions with G12/13 proteins, researchers can employ several specialized approaches:

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified recombinant sra-13 on a sensor chip

    • Flow purified G12/13 proteins over the surface

    • Measure binding kinetics (kon and koff) and equilibrium constants (KD)

    • This approach has successfully demonstrated the interaction mechanisms between Gα13 and RhoGEFs

  • GTPγS Binding Assays:

    • Measure G protein activation by quantifying the binding of non-hydrolyzable GTP analog (GTPγS)

    • Compare activation with and without receptor agonists

  • BRET-based G Protein Activation Assays:

    • Create fusion constructs of G protein subunits with luminescent/fluorescent tags

    • Measure conformational changes upon receptor activation

  • Mutagenesis Studies:

    • Create point mutations in the C-terminal and N-terminal regions of sra-13

    • Evaluate effects on G protein coupling specificity, as these regions determine receptor-G protein selectivity

What are the optimal expression systems for producing functional recombinant sra-13?

Expression SystemAdvantagesDisadvantagesTypical YieldBest Use Case
HEK293 cellsProper folding, PTMs, mammalian environmentLower yields, higher cost0.5-2 mg/LFunctional studies
CHO cellsStable cell lines, proper PTMsTime-consuming, lower yields1-3 mg/LLong-term studies
Sf9/High FiveHigher expression levelsGlycosylation differs from mammals5-10 mg/LStructural studies
E. coliLow cost, high yieldsPoor folding of membrane proteins10-50 mg/L (inclusion bodies)Antibody production
Cell-free systemsRapid, toxic protein-compatibleLower yields, expensive0.1-0.5 mg/LPreliminary screening

For functional studies of sra-13, mammalian expression systems (HEK293, CHO) are recommended due to their ability to properly fold the receptor and provide appropriate post-translational modifications. For structural studies requiring larger quantities, insect cell systems provide a good compromise between yield and protein quality. The expression system selection should align with the specific research objectives and required protein characteristics.

How can researchers design effective experimental controls when studying sra-13 signaling pathways?

Designing effective controls for sra-13 signaling research requires careful consideration:

  • Negative Controls:

    • Expression of non-functional sra-13 mutants (e.g., with deleted transmembrane domains)

    • Empty vector transfections

    • Cells treated with G12/13 pathway inhibitors

  • Positive Controls:

    • Well-characterized GPCRs known to couple to G12/13 (e.g., thrombin or LPA receptors)

    • Direct activation of G12/13 using GTPγS

    • Constitutively active G12/13 mutants

  • Specificity Controls:

    • siRNA knockdown of specific G protein subunits

    • Co-expression with dominant-negative G protein mutants

    • Pertussis toxin treatment to eliminate Gi/o signaling

  • Rescue Experiments:

    • Reintroduction of wild-type sra-13 in knockout/knockdown systems

    • Complementation with related receptors

These controls help distinguish between direct and indirect effects and validate the specificity of observed signaling pathways. When studying G12/13 pathways specifically, researchers should consider the complexity arising from most receptors coupling to multiple G proteins, especially Gαq alongside G12/13 .

What approaches can be used to identify potential ligands for recombinant sra-13?

Several methodological approaches can be employed to identify potential ligands for orphan GPCRs like sra-13:

  • Reverse Pharmacology:

    • Express sra-13 in a reporter cell line (e.g., with calcium flux or cAMP readouts)

    • Screen compound libraries (tissue extracts, peptide libraries, small molecule collections)

    • Validate hits through dose-response relationships and specificity tests

  • In Silico Screening:

    • Use homology modeling to predict sra-13 structure

    • Perform virtual screening of compound libraries

    • Select top candidates for experimental validation

  • Transcriptional Profiling:

    • Compare gene expression patterns in cells with and without sra-13 expression

    • Identify activated pathways that might indicate receptor activation

    • Test candidate ligands suggested by pathway analysis

  • Proximity-based Labeling:

    • Modify sra-13 with a promiscuous biotin ligase (BioID) or peroxidase (APEX)

    • Identify proteins in close proximity through streptavidin pull-down and mass spectrometry

    • Screen identified proteins and their natural ligands as potential sra-13 interactors

Each approach has strengths and limitations, and combining multiple methods increases the likelihood of successfully identifying bona fide ligands.

What statistical approaches are most appropriate for analyzing sra-13 signaling pathway data?

Analyzing sra-13 signaling pathway data requires robust statistical approaches to account for biological variability and experimental complexity:

  • Dose-Response Analysis:

    • Fit data to four-parameter logistic models

    • Determine EC50 values and efficacy parameters

    • Compare across experimental conditions using extra sum-of-squares F tests

  • Time-Course Analysis:

    • Apply area under the curve (AUC) calculations

    • Use repeated measures ANOVA with appropriate post-hoc tests

    • Consider non-linear mixed models for complex datasets

  • Pathway Component Analysis:

    • Perform correlation analysis between different pathway components

    • Use principal component analysis (PCA) to identify major sources of variation

    • Apply partial least squares (PLS) regression to relate receptor activation to downstream effects

  • Machine Learning Approaches:

    • Random forest classifiers can be used to predict receptor classification and function based on sequence features, similar to approaches used for other GPCRs

    • Support vector machines with appropriate feature vectors can help classify signaling outcomes

  • Multiple Testing Correction:

    • Apply Benjamini-Hochberg procedure for controlling false discovery rate

    • Use Bonferroni correction for family-wise error rate when appropriate

These statistical approaches should be selected based on the specific experimental design and research questions being addressed.

How can researchers differentiate between direct and indirect effects in sra-13 signaling cascades?

Differentiating between direct and indirect effects in sra-13 signaling requires systematic experimental designs and careful analysis:

  • Temporal Resolution Studies:

    • Measure signaling events at multiple time points (seconds to hours)

    • Establish the sequence of signaling events

    • Early events (seconds to minutes) are more likely to be direct consequences of receptor activation

  • Pharmacological Intervention:

    • Use specific inhibitors at different levels of the signaling cascade

    • Compare inhibition patterns to establish dependency relationships

    • Apply pathway-specific inhibitors to isolate effects

  • Reconstitution Experiments:

    • Use purified components in cell-free systems

    • Demonstrate direct interactions between sra-13 and G proteins

    • Similar to studies showing direct stimulation of p115RhoGEF and LARG GEF activity by Gα13

  • Protein-Protein Interaction Mapping:

    • Use proximity labeling techniques (BioID, APEX)

    • Perform co-immunoprecipitation with quantitative proteomics

    • Map the interactome at different time points after receptor activation

  • Genetic Approaches:

    • Create knockout/knockdown systems for intermediate signaling components

    • Perform epistasis analysis to establish hierarchy of components

    • Use CRISPR-Cas9 to generate specific mutations in signaling pathway components

By combining these approaches, researchers can establish which effects are directly mediated by sra-13 activation versus those that occur through secondary signaling cascades.

What are the most promising future research directions for recombinant sra-13 studies?

Several promising research directions for recombinant sra-13 studies include:

  • Structural Biology:

    • Cryo-EM structures of sra-13 in different activation states

    • Co-crystal structures with identified ligands

    • Comparison with other Class A GPCRs to identify unique structural features

  • Signaling Network Integration:

    • Systems biology approaches to map complete signaling networks

    • Mathematical modeling of G12/13 pathway dynamics

    • Integration with other GPCR signaling pathways

  • Therapeutic Applications:

    • Development of selective modulators for sra-13

    • Investigation of potential roles in disease processes

    • Utilization in regenerative medicine applications

  • Advanced Computational Approaches:

    • Deep learning methods for predicting ligand binding and receptor activation

    • Molecular dynamics simulations of complete signaling complexes

    • Network pharmacology approaches to predict pathway-level effects

  • Cross-Species Comparative Studies:

    • Functional conservation analysis across model organisms

    • Evolutionary analysis of sra-13 orthologs

    • Translation of findings from C. elegans to mammalian systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.