The full-length amino acid sequence of sra-24 (1–339 residues) includes conserved motifs typical of serpentine receptors. Below is a partial sequence representation:
| Region | Sequence |
|---|---|
| N-Terminal | MNKTAEEIVESRRCASEGLTNALTSITVKMSSVLVVTVILLSYYFARLAIRTLWKNNIFS NSTRLILLVCLLNSIIHQTTm |
| Middle | LEIRIRQIYRSIVFASEPCRLPFHFTECEVELFVYYLTT YFSTYSVFSLAFDRLISCYTPKYYLSHQYYVSIFLLFIQLIFTLGTYYVGLYGVPPLGYE PFCNYAPKLATNFVKINDFRTLIMGICIIVTVFVYYLSVKSEKQIQQTSYSPGERYIAYE NVAASQSVCILIVLQFACILISSLGVNYLRIFKSTLSDEEYNKLAPFFVGVTYANLCLPL VIHCKTKLTIRNRKLRIGVMTSMYGDVGEHINRLKKSWE |
While direct studies on sra-24 are scarce, insights can be drawn from related serpentine receptors in C. elegans:
Sensory Functions: Other sra genes (e.g., sra-11) are implicated in olfactory imprinting and chemosensation .
Structural Homology: Serpentine receptors share a conserved seven-transmembrane domain topology, critical for ligand binding and signal transduction .
Experimental Applications: Recombinant sra-24 may be used to study receptor-ligand interactions, structural biology, or functional assays in C. elegans models.
No peer-reviewed studies explicitly investigating sra-24’s function or mechanism were identified in the provided sources. Further research is needed to:
Characterize Ligands: Identify endogenous ligands or agonists.
Functional Studies: Determine its role in C. elegans physiology (e.g., sensory behavior, development).
Structural Insights: Use crystallography or cryo-EM to resolve its three-dimensional structure.
KEGG: cel:CELE_T06G6.2
UniGene: Cel.27603
Serpentine receptor class alpha-24 (sra-24) belongs to the expansive G protein-coupled receptor (GPCR) superfamily, characterized by its signature seven-transmembrane domain structure. Like other members of the serpentine receptor family, sra-24 functions through conformational changes upon ligand binding that trigger intracellular signaling cascades via G protein activation.
Serpentine receptors can exhibit rhythmic expression patterns, suggesting potential roles in temporal regulation of cellular functions. For instance, in Plasmodium falciparum, the serpentine receptor SR10 demonstrates a clear 24-hour expression rhythm, while others like SR1, SR12, and SR25 show periodicity closer to 48 hours . This temporal variation in expression may provide important clues about sra-24's physiological roles.
The functional characterization of sra-24 can be approached through comparative analysis with better-studied serpentine receptors. Based on structural classification systems, serpentine receptors may be categorized into different classes, with some belonging to Class A serpentine receptors in the hormonal receptor subclass, determined by N-terminal domain length and other structural features .
The selection of an appropriate expression system is critical for obtaining properly folded, functional recombinant sra-24. Human cell lines such as modified HEK293T cells represent a preferred system for serpentine receptor expression due to their ability to perform necessary post-translational modifications essential for receptor functionality .
When designing expression constructs, several considerations can enhance receptor expression and functionality:
Inclusion of N-terminal affinity tags to facilitate purification and detection without compromising function
Implementation of insulator elements upstream of reporter genes to improve signal-to-noise ratios in functional assays
Use of safe-harbor loci for stable, controlled expression at transcriptionally neutral genomic sites
For optimal results, researchers should consider generating cell lines with knockout of potentially interfering endogenous receptors. As demonstrated in β2AR studies, CRISPR-Cas9-mediated deletion of endogenous receptors can significantly improve the specificity of functional assays by eliminating background signaling .
Confirming both structural integrity and functional activity of recombinant sra-24 requires multiple complementary approaches. Structural verification typically begins with size analysis through SDS-PAGE and Western blotting using antibodies against the receptor or attached epitope tags.
For functional validation, cAMP-responsive element (CRE) reporter systems provide a sensitive readout of receptor activation. This approach involves generating cells that stably express the receptor of interest along with a reporter gene controlled by multimerized cAMP response elements . Upon receptor activation and subsequent cAMP production, transcription of the reporter gene is stimulated, providing a quantifiable measure of receptor functionality.
The dose-dependent nature of receptor activation should be demonstrated through concentration-response experiments with putative ligands. Analysis of response curves can provide important pharmacological parameters including EC50 values, efficacy measurements, and potential signaling biases.
A systematic mutagenesis approach represents a powerful strategy for identifying key functional domains within serpentine receptors like sra-24. Based on methodologies developed for β2AR and other GPCRs, researchers can generate and characterize thousands of receptor variants to map structure-function relationships.
The experimental design should include:
Generation of a comprehensive library containing all possible missense variants of the receptor, divided into manageable segments
Attachment of unique barcode sequences to each variant to enable high-throughput phenotyping through next-generation sequencing
Stable integration of variants into a landing pad system that ensures consistent genomic context across all mutations
Functional screening of the library at multiple ligand concentrations to generate comprehensive pharmacological profiles
This approach has been successfully employed for β2AR, where 7828 possible missense variants were synthesized, barcoded, and characterized in human cell lines . The resulting data provided detailed insights into residues critical for receptor expression, ligand binding, and signal transduction.
For sra-24, researchers should take particular care to expand cell numbers and RNA processing to ensure proper quantification of library members, especially when working with variants that may exhibit low expression or activity levels .
The identification of endogenous or synthetic ligands for orphan receptors requires strategic screening approaches. A high-throughput platform utilizing barcoded transcriptional reporters can efficiently screen large compound libraries for potential sra-24 activators or inhibitors.
The methodology involves:
Generating a cell line with stable integration of sra-24 coupled to a cAMP-responsive element (CRE) reporter gene containing a unique barcode sequence
Screening compound libraries at multiple concentrations (typically spanning 5-6 log units)
Quantifying reporter gene expression through RNA-seq to identify compounds that modulate receptor activity
Confirming hits through secondary assays measuring different aspects of receptor function
This platform has been successfully applied to characterize GPCR variants and can be adapted to identify ligands for orphan receptors like sra-24 . The inclusion of appropriate positive and negative controls is essential for distinguishing specific receptor activation from non-specific effects or toxicity.
Given that some serpentine receptors like SR10 demonstrate clear 24-hour expression rhythms , investigating potential temporal patterns in sra-24 expression and function may provide valuable insights into its physiological roles. A comprehensive temporal analysis should examine both transcriptional and post-transcriptional regulation.
For transcriptional analysis:
Collect samples at regular intervals (e.g., every 4-6 hours) over at least 48 hours under constant conditions
Measure sra-24 mRNA levels using quantitative RT-PCR or RNA-seq
Apply rhythmicity detection algorithms such as JTK_CYCLE to determine if expression follows significant 24-hour or other periodic patterns
For functional analysis:
Utilize reporter systems to measure receptor activity at different timepoints
Correlate temporal variations in receptor activity with expression levels
Investigate potential zeitgebers (timing cues) that entrain or synchronize these rhythms
This temporal characterization may reveal whether sra-24, like SR10 in P. falciparum, follows circadian patterns that could be important for its biological function in cellular signaling networks .
Robust experimental design for sra-24 characterization requires careful selection of appropriate controls to ensure data validity and interpretability. Based on established practices in GPCR research, essential controls include:
Expression controls: Cells transfected with empty vector to account for effects of the transfection process
Knockout validation: Confirmation that endogenous receptors potentially interfering with the assay have been successfully eliminated
Positive control receptors: Well-characterized GPCRs with known signaling properties to validate assay performance
Pathway controls: Direct activators of downstream signaling components to distinguish receptor-specific effects from pathway-level phenomena
For CRE reporter assays specifically, normalization to a constitutively expressed reporter (e.g., Renilla luciferase) is essential to control for transfection efficiency variations across samples . Additionally, including wild-type receptor alongside mutants or variants enables direct comparison of pharmacological parameters.
The experimental design should also account for potential sources of variability, including cell passage number, transfection efficiency, and detection sensitivity. Maintaining consistent conditions across experiments enhances reproducibility and facilitates meaningful comparisons between different receptor variants or ligands.
When investigating sra-24 function in complex biological systems where randomization or complete experimental control is challenging, quasi-experimental study designs offer valuable alternatives. These approaches attempt to establish causal relationships while controlling for potential confounding factors.
Key quasi-experimental designs applicable to sra-24 research include:
Interrupted time series: Measuring outcomes before and after a specific intervention (e.g., receptor inhibition)
Difference-in-differences (DID): Comparing changes over time between intervention and control groups
Regression discontinuity design: Analyzing outcomes on either side of a threshold value
When implementing these designs, researchers should:
Clearly define the study's sampling and allocation procedures
Establish explicit inclusion and exclusion criteria
Determine appropriate measurement timing relative to the intervention
Apply suitable analytical methods to control for potential confounding
The checklist proposed for quasi-experimental studies emphasizes addressing key questions about clustering, outcome data availability, intervention effect estimation, and control for confounding to enhance study validity . These considerations are particularly important when studying serpentine receptors in complex physiological contexts where multiple signaling pathways may interact.
Membrane proteins like serpentine receptors present unique challenges for structural and functional studies due to their hydrophobic nature and conformational flexibility. Several methodological approaches can overcome these challenges:
Stable cell line generation: Creating cell lines with controlled, consistent expression using landing pad integration systems at transcriptionally silent genomic loci
Receptor stabilization: Introducing mutations or utilizing fusion proteins to enhance stability without compromising function
Solubilization strategies: Employing detergents, nanodiscs, or lipid cubic phase systems that maintain the native-like lipid environment
For functional studies specifically, the barcoded transcriptional reporter approach provides significant advantages by enabling:
Quantitative measurement of receptor activation through reporter gene transcription
Multiplexed analysis of numerous receptor variants simultaneously
Dose-response characterization across multiple ligand concentrations
The inclusion of sequence elements such as insulators upstream of reporter genes and N-terminal affinity tags can significantly improve signal-to-noise ratios in functional assays, enabling more sensitive detection of receptor activity .
Proper analysis of dose-response data is essential for deriving meaningful pharmacological parameters that characterize sra-24 function. The analytical workflow should include:
Data normalization: Adjusting raw values to account for baseline activity and maximum response capacity
Curve fitting: Applying appropriate mathematical models (typically four-parameter logistic regression) to determine EC50, Emax, and Hill coefficient values
Statistical comparison: Employing appropriate statistical tests to compare parameters across different experimental conditions
The following table illustrates typical pharmacological parameters derived from dose-response analysis for serpentine receptor activation:
| Parameter | Definition | Typical Range | Biological Significance |
|---|---|---|---|
| EC50 | Concentration producing 50% of maximal response | 10⁻¹² to 10⁻⁶ M | Measure of potency |
| Emax | Maximum response elicited | 0-100% (relative) | Measure of efficacy |
| Hill Coefficient | Slope of dose-response curve | 0.5-2.0 | Indicator of cooperativity |
| Basal Activity | Response in absence of ligand | 0-20% of Emax | Indicator of constitutive activity |
When comparing multiple ligands or receptor variants, researchers should consider not only differences in potency (EC50) but also potential changes in efficacy (Emax) or response kinetics that may indicate distinct signaling mechanisms or biases .
Identifying sra-24 orthologs across species requires sophisticated bioinformatic approaches that account for the evolutionary diversity of serpentine receptors. A comprehensive identification strategy should include:
Sequence-based approaches:
BLAST searches against genomic and transcriptomic databases
Hidden Markov Model (HMM) profile searches to detect distant homologs
Analysis of conserved motifs characteristic of class A serpentine receptors
Structural prediction:
Identification of proteins with predicted seven-transmembrane topology
Analysis of conserved functional residues in transmembrane domains
Phylogenetic analysis:
Construction of multiple sequence alignments and phylogenetic trees
Consideration of synteny and genomic context
It's important to note that some receptor families may have functional analogs rather than true orthologs in distant species. For example, KIR receptors have no structural orthologs in non-primates, although mouse Ly49 proteins serve analogous functions . This evolutionary divergence must be considered when interpreting cross-species comparisons of serpentine receptors.
Integration of transcriptomic and proteomic data provides a comprehensive understanding of sra-24 regulation at multiple levels. This multi-omics approach should:
Compare mRNA and protein abundance across different conditions to identify potential post-transcriptional regulation
Examine temporal dynamics to detect delays between transcription and translation
Investigate rhythmic patterns at both transcript and protein levels
Analyze co-expressed genes and proteins to identify regulatory networks
For studying temporal expression patterns specifically, algorithms like JTK_CYCLE can identify significant rhythmicity in expression data. This approach revealed that among P. falciparum serpentine receptors, only SR10 showed a clear 24-hour expression rhythm while others displayed approximately 48-hour periodicity .
RNA harvesting protocols should be carefully designed to capture temporal variations. For instance, in studies of gene expression in Steinernema nematodes, specific protocols were developed to collect RNA from animals at different developmental stages . Similar approaches may be valuable for characterizing the temporal dynamics of sra-24 expression.
Successful expression and purification of functional recombinant serpentine receptors often encounters challenges due to their hydrophobic nature and complex folding requirements. Several strategies can address these issues:
Expression construct optimization:
Codon optimization for the host expression system
Inclusion of N-terminal signal sequences to enhance membrane targeting
Addition of stabilizing mutations in flexible regions
Fusion with proteins that enhance folding and stability
Cell line engineering:
Generation of cell lines with enhanced protein folding capacity
Knockout of potentially interfering endogenous receptors
Incorporation of chaperones that facilitate membrane protein folding
Culture condition optimization:
Adjustment of induction parameters (timing, temperature, inducer concentration)
Supplementation with ligands that stabilize the receptor during expression
Use of chemical chaperones to enhance folding efficiency
For purification specifically, careful selection of detergents and buffer components is essential to maintain receptor stability and functionality throughout the process. The inclusion of appropriate ligands during purification can significantly enhance receptor stability by locking it in a specific conformational state.
Inconsistent results in functional assays often stem from variability in receptor expression, cell health, or assay conditions. A systematic troubleshooting approach should address:
Expression level variability:
Implement stable integration systems like the Bxb1-landing pad at safe-harbor loci
Verify single integration events per cell to ensure consistent expression
Monitor receptor expression levels across experiments
Assay sensitivity:
Include insulator elements upstream of reporter genes to improve signal-to-noise ratio
Optimize reporter gene selection for the specific signaling pathway being studied
Implement internal normalization controls to account for transfection efficiency
Cell line characteristics:
Confirm knockout of potentially interfering endogenous receptors
Monitor cell passage number and maintain consistent culture conditions
Verify cell line identity through STR profiling and mycoplasma testing
Flow cytometry can be particularly valuable for assessing integration efficiency and expression consistency. In studies with β2AR, flow cytometry was used to verify single integration events and monitor expression of fluorescent reporters . Similar approaches can be applied to sra-24 expression systems to ensure consistent results across experiments.
Several cutting-edge technologies show particular promise for advancing sra-24 research:
Single-cell transcriptomics and proteomics:
Revealing cell-type-specific expression patterns
Identifying rare cell populations with unique sra-24 signaling properties
Mapping temporal dynamics at single-cell resolution
CRISPR-based technologies:
Precise genome editing to study sra-24 function in native contexts
CRISPRi/CRISPRa systems for temporal control of expression
Base editing for introducing specific mutations without double-strand breaks
Structural biology approaches:
Cryo-electron microscopy for determining sra-24 structure in different activation states
Hydrogen-deuterium exchange mass spectrometry for mapping conformational changes
Molecular dynamics simulations to predict ligand binding and activation mechanisms
Advanced imaging techniques:
Super-resolution microscopy to visualize receptor clustering and trafficking
FRET/BRET sensors to monitor receptor activation in real-time
Multiplexed imaging to simultaneously track multiple signaling components
These technologies, combined with the experimental approaches and analytical frameworks discussed throughout these FAQs, will drive progress in understanding the fundamental biology of sra-24 and its potential applications in basic research and therapeutic development.
Despite advances in serpentine receptor research, several fundamental questions about sra-24 remain to be addressed:
Ligand identification: What are the endogenous ligands that activate sra-24 in physiological contexts?
Signaling specificity: Which G protein subtypes couple to sra-24, and does this coupling specificity vary in different cellular environments?
Temporal regulation: Does sra-24 expression or function follow circadian or other temporal patterns, as observed for SR10 in P. falciparum ?
Structural determinants: Which specific residues and domains are critical for ligand recognition, G protein coupling, and receptor activation?
Physiological roles: What are the broad biological functions of sra-24 in development, homeostasis, and disease processes?
Addressing these questions will require integrated approaches combining genomics, proteomics, structural biology, and functional studies in relevant biological systems. The methodological frameworks outlined in these FAQs provide valuable tools for tackling these challenging but important questions about sra-24 biology.