Recombinant Serpentine receptor class alpha-28 (sra-28)

Shipped with Ice Packs
In Stock

Description

Research Context and Functional Insights

While direct studies on sra-28 are sparse, its classification within the serpentine receptor family suggests roles in:

  • Chemosensory Perception: GPCRs in C. elegans mediate responses to environmental cues, such as odorants and tastants .

  • Neuronal Signaling: Serpentine receptors like sre-19 regulate behaviors such as olfactory memory in C. elegans .

Production and Applications

Recombinant sra-28 is commercially available for research purposes, with applications likely including:

  • Mechanistic Studies: Investigating GPCR-mediated signaling pathways in C. elegans.

  • Antibody Development: Serving as an antigen for generating custom antibodies .

Production protocols involve E. coli expression systems, though yield and purity metrics are unspecified. Stability testing under varying storage conditions is recommended due to potential protein aggregation during shipping .

Future Directions

Key unresolved questions include:

  • Functional Characterization: Ligand specificity, downstream signaling partners, and tissue-specific expression patterns.

  • Structural Analysis: Cryo-EM or X-ray crystallography to resolve its 3D conformation.

Comparative studies with related receptors (e.g., sra-27, sre-19) may elucidate shared or unique roles in C. elegans biology .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
sra-28; F18C5.6; Serpentine receptor class alpha-28; Protein sra-28
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-341
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
sra-28
Target Protein Sequence
MSSECARSDVHNVLTSDSMKFNHCFIISIIIISFFTTTKSVRVLLKQNLLPTCTRNLLFS AIINGIIHQCVTAVIRLRAFYHAIVYASDPCAILFQSSQCFFDGNLYYYTNLFSSFCCFS LFLDRLFSFKPRSSYHNHQTLASIVLILSQIVLPIGPLYWVFYDAFYTSYVLMCTYPPPM SVMKLHEVNNIRICVLIVLLFFAIFLYIHNKIREKRMVHNVYNINSRYKSYENYLATKSV CIVIFSQILCVGPTSSITSVFIRFRDSIPLEWFHLIISYLTGLTYSNFLLPLIILYQDKQ IAKKRRIMIQRLQNKNETSFDHFDTLKSLWGKKTGNQETLF
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_F18C5.6

UniGene: Cel.26477

Protein Families
Nematode receptor-like protein sra family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for recombinant sra-28 protein?

For long-term storage of recombinant sra-28 protein:

  • Store at -20°C or -80°C for extended periods

  • Use Tris-based buffer with 50% glycerol, optimized for protein stability

  • Avoid repeated freeze-thaw cycles as they can compromise protein integrity

  • For working applications, aliquots can be stored at 4°C for up to one week

  • Lyophilized preparations may provide additional stability for shipping and long-term storage

The addition of glycerol serves as a cryoprotectant that prevents protein denaturation during freezing, similar to storage protocols used for other recombinant serpentine receptors .

What expression systems are most suitable for producing functional recombinant sra-28?

Several expression systems can be used for producing recombinant sra-28, each with distinct advantages:

Expression SystemAdvantagesLimitationsBest Applications
E. coliHigh yield, cost-effective, rapid expressionMay require refolding, limited post-translational modificationsStructural studies, antibody generation
Insect cells (Sf9, Hi5)Better protein folding, some post-translational modificationsModerate yield, more complex culture conditionsFunctional assays, ligand binding studies
Mammalian cells (HEK293, CHO)Native-like folding, complete post-translational modificationsLower yield, expensive, time-consumingSignal transduction studies, complex interactions

E. coli expression has been successfully employed for producing recombinant serpentine receptors, including sra-28, particularly when fused to N-terminal His tags to facilitate purification . For functional studies requiring proper membrane insertion and post-translational modifications, eukaryotic expression systems may be preferable.

What purification strategies yield the highest purity for recombinant sra-28?

A multi-step purification approach is recommended:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using His-tag affinity

  • Intermediate purification: Size exclusion chromatography to remove aggregates and impurities

  • Polishing: Ion exchange chromatography if higher purity is required

For membrane proteins like sra-28, inclusion of suitable detergents throughout the purification process is critical. The final preparation should achieve >90% purity as determined by SDS-PAGE .

What are the predicted functional partners of sra-28 based on interaction networks?

STRING database analysis reveals several high-confidence protein interaction partners for sra-28:

ProteinDescriptionInteraction Score
sru-48Serpentine Receptor, class U0.901
srh-11Serpentine Receptor, class H0.854
srsx-30G-protein coupled receptor family 10.691
srn-1Serpentine Receptor, class N0.691
srbc-58Serpentine Receptor, class BC0.690
srm-2Serpentine Receptor, class M0.672

These high confidence interactions suggest functional cooperation or redundancy within the serpentine receptor network, potentially forming sensory receptor complexes that mediate specific chemosensory responses .

How can I design effective binding assays to identify potential ligands for sra-28?

A comprehensive approach to ligand identification includes:

  • In vitro binding assays:

    • Prepare purified recombinant sra-28 in suitable membrane mimetics (nanodiscs or liposomes)

    • Screen candidate ligands using techniques such as surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC)

    • Validate hits with competition binding assays

  • Cell-based functional assays:

    • Express sra-28 in heterologous systems coupled to calcium or cAMP reporters

    • Measure activation in response to candidate compounds

    • Use BRET or FRET-based assays to detect conformational changes upon ligand binding

  • In vivo C. elegans assays:

    • Compare chemotaxis responses between wild-type and sra-28 mutant worms

    • Implement C. elegans survival assays to determine if sra-28 mediates responses to specific compounds

    • Use calcium imaging in identified neurons expressing sra-28

What approaches are most effective for generating sra-28 mutants in C. elegans?

Several genetic manipulation strategies can be employed:

MethodApproachAdvantagesConsiderations
CRISPR-Cas9Design guide RNAs targeting early exonsPrecise editing, complete knockoutRequires screening, potential off-targets
RNAiFeed worms bacteria expressing dsRNARapid, tissue-specific optionsIncomplete knockdown, variable efficiency
Transgenic rescueExpress wild-type sra-28 in mutant backgroundConfirms specificity, allows structure-functionPotential overexpression artifacts
Tissue-specific knockoutUse tissue-specific promoters to drive Cas9Dissect cell-autonomous functionsComplex cloning, expression validation needed

For tissue-specific manipulation, the somatic RNAi approach using strains like rrf-1(lf) and ppw-1(lf) can help distinguish between somatic and germline functions, similar to approaches used for other genes in C. elegans .

How can I determine the expression pattern of sra-28 in C. elegans?

To characterize the cellular expression pattern of sra-28:

  • Transcriptional reporters: Generate constructs with the sra-28 promoter driving fluorescent protein expression

  • Translational fusion: Create sra-28::GFP fusion proteins to visualize subcellular localization

  • Single-nucleus RNA sequencing: Recent advances in single-nucleus sequencing of C. elegans neurons can identify specific neural populations expressing sra-28

Based on patterns observed with other serpentine receptors, sra-28 is likely expressed in specific chemosensory neurons such as those in the amphid sensory organs in the head or phasmid sensory neurons in the tail .

How does sra-28 relate to other serpentine receptor families in C. elegans?

Serpentine receptors in C. elegans are organized into approximately 20 recognizable families based on sequence similarity and shared intron locations:

  • Superfamily organization:

    • sra-28 belongs to the Sra superfamily, which includes sra, srab, srb, and sre families

    • Other major superfamilies include Srg (srg, srt, sru, srv, srx, srxa) and Str (srd, srh, sri, srj, str)

    • "Solo" families include srbc, srsx, srw, and srz

  • Evolutionary patterns:

    • Comparative genomic analyses between C. elegans and C. briggsae show differential expansion of the sra family

    • The expansion is due to multiple rounds of tandem duplication and translocation of individual genes

    • This pattern suggests rapid evolution of chemosensory receptors to adapt to different ecological niches

What experimental evidence supports the chemosensory function of serpentine receptors like sra-28?

Several lines of evidence support the chemosensory role of serpentine receptors:

  • Expression patterns: Serpentine receptors from the sra family are expressed in known chemosensory neurons, including those in the amphids and phasmids, supporting their role in detecting environmental chemicals

  • Functional studies: C. elegans survival assays have demonstrated that serpentine receptors mediate responses to environmental stimuli, including bacterial detection and chemical sensing

  • Structural features: The presence of seven transmembrane domains and extracellular ligand-binding regions is consistent with detection of chemical signals from the environment

  • Evolutionary expansion: The massive expansion of chemosensory receptor genes in nematodes (comprising 1-5% of the genome) reflects their critical importance in chemical perception for organisms lacking visual and auditory systems

How can single-cell transcriptomic approaches enhance our understanding of sra-28 function?

Single-cell/single-nucleus RNA sequencing offers powerful insights:

  • Cell-type specific expression: Recent advances in single-nucleus sequencing have successfully identified expression patterns of serpentine receptors in specific adult C. elegans neurons

  • Conditional regulation: The serpentine receptor gene srz-64, for example, was found to be highly expressed in adult ADL neuron clusters but not present in L4 stage data, revealing stage-specific expression patterns

  • Mutant analysis: Comparisons between wild-type and mutant backgrounds (e.g., daf-2 insulin signaling mutants) have revealed differential regulation of serpentine receptors, suggesting integration with metabolic and developmental signaling networks

  • Co-expression networks: Identification of genes co-expressed with sra-28 can reveal functional modules and signaling pathways

What role might sra-28 play in the context of C. elegans development and behavior?

While specific functions of sra-28 remain to be fully characterized, insights from related serpentine receptors suggest potential roles:

  • Developmental timing: Serpentine receptors may interact with heterochronic pathways that control developmental progression, such as the LIN-28 pathway which regulates temporal cell fate transitions in C. elegans

  • Environmental sensing: Chemosensory receptors in C. elegans detect environmental cues that influence behaviors such as feeding, mate-finding, and predator avoidance

  • Longevity regulation: Some serpentine receptors influence lifespan through integration with metabolic and stress response pathways

  • Host-pathogen interactions: C. elegans survival assays suggest roles for chemosensory receptors in detecting pathogenic bacteria, potentially including sra-28

What are the common technical challenges in working with recombinant serpentine receptors?

Researchers should anticipate several challenges:

  • Protein stability: Membrane proteins like sra-28 are often unstable when removed from their native lipid environment. Use of stabilizing agents (glycerol, specific detergents) is essential

  • Functional reconstitution: Maintaining native-like activity requires careful consideration of membrane mimetics (nanodiscs, liposomes) or detergent systems

  • Ligand identification: The natural ligands for most serpentine receptors remain unknown, making functional characterization challenging

  • Redundancy: Functional redundancy among related serpentine receptors may mask phenotypes in single gene mutants, necessitating multiple gene knockouts

  • Expression level: Achieving sufficient expression for biochemical studies while avoiding aggregation or misfolding requires careful optimization of expression conditions

How can I design experiments to determine G-protein coupling specificity of sra-28?

To characterize G-protein coupling:

  • Heterologous expression systems:

    • Express sra-28 in mammalian cells with various G-protein subunits

    • Measure second messenger production (cAMP, calcium, etc.)

    • Use BRET/FRET sensors to directly detect receptor-G protein interactions

  • In vivo approaches:

    • Generate C. elegans strains with mutations in different G-protein subunits

    • Assess how these mutations modify sra-28-dependent behaviors

    • Use calcium imaging to measure neuronal activity in these genetic backgrounds

  • Structural approaches:

    • Homology modeling based on solved GPCR-G protein complexes

    • Identify potential G-protein coupling interfaces

    • Test predictions with site-directed mutagenesis

Understanding G-protein coupling is essential for interpreting downstream signaling events and placing sra-28 within the broader context of C. elegans signal transduction networks .

How might comparative analysis of sra-28 inform research on parasitic nematode biology?

Insights from sra-28 research could have implications for parasitic nematode control:

  • Target identification: Chemosensory receptors represent potential targets for controlling parasitic nematodes that cause human, animal, and plant diseases

  • Species-specific interventions: Understanding the ligand specificity of sra-28 homologs in parasitic species could lead to the development of species-specific attractants, repellents, or antagonists

  • Host detection mechanisms: Comparative analysis between free-living (C. elegans) and parasitic nematodes may reveal how chemosensory systems have evolved for host detection and parasitism

  • Drug screening platforms: Heterologous expression of parasitic nematode sra-28 homologs could facilitate high-throughput screening for compounds that selectively target these receptors

How can CRISPR-based approaches advance our understanding of sra-28 function?

CRISPR technologies offer sophisticated tools beyond simple knockouts:

  • Precise domain modifications: Introduction of specific mutations to test structure-function hypotheses

  • Endogenous tagging: Addition of fluorescent or affinity tags to study localization and interactions

  • Conditional systems: Implementation of conditional alleles for temporal control of sra-28 function

  • Base editing: Introduction of specific amino acid changes without double-strand breaks

  • CRISPRi/a: Modulation of expression levels without altering the gene sequence

These approaches can overcome limitations of traditional knockout or RNAi methods, allowing more nuanced investigation of sra-28 function in vivo.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.