Recombinant Serpentine receptor class alpha-31 (sra-31)

What is Serpentine receptor class alpha-31 (sra-31) and where is it primarily expressed?

Serpentine receptor class alpha-31 (sra-31) is a G-protein coupled receptor (GPCR) encoded by the sra-31 gene in Caenorhabditis elegans. It belongs to the serpentine receptor class alpha family, which comprises a significant portion of the C. elegans chemosensory receptor repertoire. The full-length protein consists of 338 amino acids and is characterized by its seven-transmembrane domain structure. The protein is encoded by the C56C10.5 open reading frame (ORF) in the C. elegans genome. The amino acid sequence begins with MEIPGKCTSEEIRLTLTSSFMMGNHCFILLIIISSVFLTVFAIRKLWKNNIFPNCTRTLL and continues through the full 338-residue sequence as documented in UniProt database (Q18881) .

What are the structural characteristics of the sra-31 protein?

The sra-31 protein exhibits typical serpentine receptor architecture with seven transmembrane domains characteristic of G-protein coupled receptors. The full amino acid sequence reveals several key structural features:

• N-terminal extracellular domain containing potential ligand-binding sites

• Seven hydrophobic transmembrane domains that anchor the protein in the cell membrane

• Intracellular loops involved in G-protein coupling and signal transduction

• C-terminal domain with potential phosphorylation sites for receptor regulation

The protein contains multiple cysteine residues that may form disulfide bonds critical for maintaining the three-dimensional structure of the receptor. The sequence (MEIPGKCTSEEIRLTLTSSFMMGNHCFILLIIISSVFLTVFAIRKLWKNNIFPNCTRTLL FSAIINGVVHHWSIAGIRIRTVYRALVYGSDRCSILFQSSECLIESNLYYYTNLFSSLCC ISLFFDRLLSLNAKTSYNTKHFSKIFLLFQSISPFGILYWIFYDSVYTGFVPMCSYPPAT SSLKFHKVNEFRLYILGTFFVLSFVIFFYNRTQEKGIIHNVYDTESRYKSYENLLATRAV CIIIATQITCLVTTASTTEILSAYKSSIPNTILLPSIAFMTGLTYSNFFLPIIIIYQTNR IINQRYNAIKRIQNEKSFATHFASLDLSWKSSKIDNSS) reveals hydrophobic regions consistent with membrane-spanning domains .

What are the recommended storage conditions for recombinant sra-31 protein?

For optimal stability and activity of recombinant sra-31 protein, the following storage conditions are recommended:

• Long-term storage: -20°C or -80°C in a Tris-based buffer containing 50% glycerol

• Working aliquots: Store at 4°C for up to one week

• Avoid repeated freeze-thaw cycles as this can lead to protein denaturation and loss of activity

The protein is typically supplied as a 50 μg quantity in a storage buffer optimized for stability. When preparing working aliquots, it is advisable to minimize the number of freeze-thaw cycles by making single-use aliquots before freezing .

What recombineering approaches are most effective for generating sra-31 mutants?

When generating sra-31 mutants for functional studies, λ Red-based recombineering has proven to be an efficient method. This homologous recombination-based genetic engineering approach involves six critical steps:

• Generation of appropriate linear targeting substrate DNA with homology arms flanking the sra-31 gene

• Provision of the λ Red recombination genes (exo, bet, gam) in the host organism

• Induction of the λ recombination genes to activate the recombination machinery

• Preparation of electrocompetent cells and electroporation of the linear targeting DNA

• Post-electroporation outgrowth to allow recombination to occur

• Identification and validation of successful recombinant clones through PCR, restriction enzyme analysis, and sequencing

For sra-31 targeting, PCR primers should include 70 nucleotides of homology to the genomic regions flanking the desired insertion or deletion site. This approach allows for precise genetic modifications with minimal off-target effects .

How can one optimize heterologous expression of functional sra-31 protein?

Optimizing heterologous expression of functional sra-31 protein requires careful consideration of several factors:

• Expression System Selection:

  • Bacterial systems (E. coli): Suitable for high yield but may lack post-translational modifications

  • Yeast systems (S. cerevisiae, P. pastoris): Better for membrane proteins with proper folding

  • Insect cell systems (Sf9, High Five): Preferred for GPCRs due to membrane composition similarity to mammalian cells

  • Mammalian cell systems (HEK293, CHO): Best for maintaining native protein folding and modifications

• Codon Optimization:

  • Analyzing the C. elegans sra-31 sequence for rare codons in the host organism

  • Redesigning the coding sequence to match codon usage of the expression host

• Fusion Tags:

  • N-terminal tags: May disrupt signal peptide function

  • C-terminal tags: Generally better for maintaining receptor function

  • Recommended tags: His6 for purification, GFP for localization studies

• Expression Conditions:

  • Temperature: Lower temperatures (16-25°C) often improve proper folding

  • Induction time: Extended gentle induction rather than high-level rapid expression

  • Media supplements: Addition of ligands or stabilizing agents during expression

Validation of functional expression should include both western blotting and functional assays to confirm that the recombinant protein maintains its native structure and activity .

What are the key considerations when designing sra-31 domain swap experiments?

When designing domain swap experiments to investigate structure-function relationships in sra-31:

• Domain Boundary Identification:

  • Analyze the full amino acid sequence (338 residues) to accurately identify transmembrane domains, loops, and termini

  • Use multiple prediction algorithms to confirm domain boundaries

  • Consider evolutionary conservation when selecting swap regions

• Chimera Design Strategy:

  • Select domains from functionally characterized related receptors

  • Maintain proper protein folding by preserving critical intramolecular interactions

  • Design multiple constructs with varying junction points to optimize chimera functionality

• Molecular Cloning Approach:

  • Use overlap extension PCR or recombineering for seamless domain swapping

  • Design junction points within conserved regions to minimize disruption

  • Include flexible linkers if necessary to maintain proper domain orientation

• Functional Validation:

  • Compare expression levels between wild-type and chimeric receptors

  • Assess membrane localization using fluorescent tags or surface biotinylation

  • Perform ligand binding and signal transduction assays to characterize altered function

A systematic approach to domain swapping can provide valuable insights into the structural determinants of sra-31 function, ligand specificity, and signaling properties .

What is the optimal experimental design for studying sra-31 function in C. elegans?

When designing experiments to study sra-31 function in C. elegans, researchers should consider a multi-tiered approach:

• Genetic Manipulation Strategies:

  • CRISPR/Cas9 gene editing for precise mutations or insertions

  • RNAi knockdown for rapid but transient functional assessment

  • Transgenic overexpression to study gain-of-function phenotypes

  • Recombineering in fosmids for creating reporter fusions with native regulatory elements

• Phenotypic Assays:

  • Chemotaxis assays to identify potential ligands

  • Electrophysiological recordings from neurons expressing sra-31

  • Calcium imaging using GCaMP reporters in sra-31-expressing cells

  • Lifespan and stress response measurements to detect physiological roles

• Experimental Controls:

  • Wild-type N2 strains as baseline controls

  • Multiple independently generated mutant/transgenic lines

  • Rescue experiments to confirm phenotype attribution to sra-31

  • Related receptor mutants to assess specificity

• Data Collection Parameters:

  • Standardized growth conditions (temperature, media composition)

  • Age-synchronized populations for consistent developmental stage

  • Blinded scoring to prevent experimental bias

  • Sufficient biological and technical replicates (minimum n=3 experiments with 30+ worms each)

This comprehensive experimental design enables robust characterization of sra-31 function while minimizing confounding variables and ensuring reproducibility .

How should recombineering be implemented for studying sra-31 in BAC or fosmid constructs?

Implementing recombineering for studying sra-31 in Bacterial Artificial Chromosome (BAC) or fosmid constructs involves the following optimized protocol:

• Selection of Appropriate Vectors:

  • Choose BACs or fosmids containing the complete sra-31 locus including regulatory regions

  • Verify sequence integrity before modification

  • Consider using vectors with conditional copy number control

• Recombineering System Setup:

  • Use bacterial strains expressing λ Red recombination proteins (exo, bet, gam)

  • Options include DY380, SW102, or bacteria containing pSIM plasmids

  • Ensure temperature-sensitive expression control of recombination proteins

• Targeting Construct Design:

  • PCR amplify selectable markers flanked by homology arms (40-70 bp) targeting desired sra-31 regions

  • For reporter fusions, design in-frame insertions that maintain protein function

  • Include FRT or loxP sites if marker removal is desired after recombineering

• Verification Methods:

  • Colony PCR across integration junctions

  • Restriction enzyme digestion patterns

  • Sequencing of modified regions

  • Functional testing in appropriate expression systems

This approach allows precise genetic engineering of sra-31 while maintaining the genomic context necessary for proper expression and regulation .

What methodologies are recommended for investigating sra-31 ligand interactions?

To investigate sra-31 ligand interactions, researchers should employ a multi-faceted approach combining computational, biochemical, and functional methods:

• In Silico Screening and Docking:

  • Homology modeling of sra-31 based on crystallized GPCRs

  • Virtual screening of compound libraries against the predicted binding pocket

  • Molecular dynamics simulations to evaluate binding stability

  • Identification of key residues for mutagenesis

• Ligand Binding Assays:

  • Radioligand binding with tritiated potential ligands

  • Fluorescence-based binding assays using labeled ligands

  • Surface plasmon resonance for direct binding kinetics

  • Thermal shift assays to detect ligand-induced stability changes

• Functional Response Assays:

  • GTPγS binding to measure G-protein activation

  • BRET/FRET-based assays for conformational changes

  • Calcium mobilization in heterologous expression systems

  • cAMP or IP3 production measurement for downstream signaling

• Structure-Activity Relationship Studies:

  • Systematic modification of candidate ligands

  • Correlation of chemical properties with binding affinity

  • Competition assays to define binding specificity

  • Analysis of species-specific variations in ligand recognition

These complementary approaches provide robust evidence for ligand identification and characterization of binding mechanisms, enabling the development of specific modulators for sra-31 .

How should researchers address inconsistent expression levels of recombinant sra-31?

Inconsistent expression of recombinant sra-31 is a common challenge that can be systematically addressed through the following approach:

• Expression System Optimization:

  • Test multiple expression systems (bacterial, yeast, insect, mammalian)

  • Evaluate different cell lines within each system

  • Optimize induction parameters (temperature, inducer concentration, timing)

  • Consider specialized expression strains designed for membrane proteins

• Construct Design Refinement:

  • Modify fusion tags (position, type, inclusion of cleavage sites)

  • Incorporate stabilizing mutations identified through alanine scanning

  • Add trafficking signals to improve membrane localization

  • Test truncated constructs to identify problematic domains

• Expression Condition Matrix:

  Parameter	Variables to Test	Monitoring Method
  Temperature	16°C, 20°C, 25°C, 30°C	Western blot
  Induction time	4h, 8h, 16h, 24h	Flow cytometry
  Media supplements	Glycerol, DMSO, specific lipids	Fluorescence microscopy
  Cell density at induction	OD600: 0.4, 0.8, 1.2	Functional assays

• Troubleshooting Specific Issues:

  • Protein aggregation: Add solubilizing agents or chaperone co-expression

  • Proteolytic degradation: Test protease inhibitor cocktails or protease-deficient strains

  • Low membrane incorporation: Optimize signal sequences or use fusion partners known to enhance membrane targeting

  • Toxicity to host cells: Use tightly regulated inducible promoters or lower copy number vectors

By systematically troubleshooting expression issues using this framework, researchers can identify optimal conditions for consistent and functional sra-31 expression .

What statistical approaches are recommended for analyzing sra-31 functional data?

When analyzing functional data for sra-31, appropriate statistical methods should be selected based on the experimental design and data characteristics:

• Dose-Response Analysis:

  • Nonlinear regression to determine EC50/IC50 values

  • Four-parameter logistic model fitting for complete dose-response curves

  • Comparison of curves using extra sum-of-squares F test

  • Bootstrap analysis for confidence interval determination

• Behavioral Assay Analysis:

  • Two-way ANOVA for comparing mutant vs. wild-type responses across conditions

  • Repeated measures designs for time-course experiments

  • Bonferroni or Tukey post-hoc tests for multiple comparisons

  • Non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) for non-normally distributed data

• Expression Level Correlations:

  • Pearson or Spearman correlation between expression and function

  • Multiple regression to account for covariates

  • ANCOVA when comparing groups while controlling for expression level

• Power Analysis Guidelines:

  Effect Size	Minimum Sample Size	Statistical Test
  Large (d>0.8)	n=12 per group	t-test or ANOVA
  Medium (d=0.5)	n=28 per group	t-test or ANOVA
  Small (d=0.2)	n=156 per group	t-test or ANOVA
  Correlation r=0.3	n=85 total	Correlation

• Reporting Requirements:

  • Include exact p-values rather than thresholds

  • Report effect sizes alongside significance

  • Document all data transformations

  • Include appropriate graphs with error bars representing standard error or confidence intervals

These statistical approaches ensure robust interpretation of sra-31 functional data while minimizing false positives and accounting for experimental variability .

How can researchers optimize recombineering efficiency for sra-31 gene modifications?

Optimizing recombineering efficiency for sra-31 gene modifications requires attention to several critical factors:

• Homology Arm Design:

  • Length optimization: 50-70 bp homology arms for most applications

  • Sequence uniqueness: Verify arms don't have homology elsewhere in the genome

  • GC content: Aim for 40-60% GC content in homology regions

  • Avoid repetitive sequences or secondary structures

• Electroporation Parameter Optimization:

  Cell Type	Voltage	Capacitance	Resistance	Cuvette	Recovery Media
  DY380	1.8 kV	25 μF	200 Ω	1 mm	SOC with glucose
  SW102	1.75 kV	25 μF	200 Ω	1 mm	SOC with glucose
  pSIM strains	1.8 kV	25 μF	200 Ω	1 mm	SOC with glucose

• λ Red Induction Optimization:

  • Precise temperature control: 42°C water bath for exactly 15 minutes

  • Culture density: Induce at mid-log phase (OD600 = 0.4-0.6)

  • Cooling: Rapid cooling on ice immediately after induction

  • Washing: Multiple gentle washes to remove salts before electroporation

• Troubleshooting Recombination Efficiency:

  • Low efficiency: Increase DNA concentration, optimize induction timing

  • False positives: Design PCR strategies that detect only correct integrations

  • No recombinants: Check inducer function, competent cell quality

  • Off-target recombination: Redesign homology arms for greater specificity

• Selection Strategy Refinement:

  • Two-step selection/counter-selection for seamless modifications

  • Dual selectable markers for complex modifications

  • Temperature-sensitive selection for conditional alleles

  • Galactose-based counter-selection for removing selectable markers

By optimizing these parameters, researchers can achieve recombination efficiencies of 10^-4 to 10^-2 (1-100 recombinants per 10^4 viable cells), significantly enhancing the success rate of sra-31 gene modifications .

What are the emerging applications of recombinant sra-31 in neurobiology research?

Recombinant sra-31 has several emerging applications in neurobiology research that extend beyond traditional chemosensory studies:

• Neural Circuit Mapping:

  • Optogenetic tagging of sra-31-expressing neurons

  • GRASP (GFP Reconstitution Across Synaptic Partners) to identify synaptic connections

  • Calcium imaging to visualize activity patterns in response to stimuli

  • Connectome analysis to place sra-31 neurons in broader neural networks

• Sensory Integration Studies:

  • Investigation of multimodal sensory processing

  • Cross-talk between chemosensation and other sensory modalities

  • Neuroplasticity in sra-31-expressing circuits during learning

  • Comparative analysis across nematode species to understand evolutionary adaptations

• Aging and Neurodegeneration Models:

  • Changes in sra-31 expression and function during aging

  • Role in neuroprotection or vulnerability to cellular stress

  • Potential as a target for modulating longevity pathways

  • Model for studying protein misfolding in membrane proteins

• Drug Discovery Applications:

  • High-throughput screening platforms using sra-31-based biosensors

  • Structure-guided design of modulators for related human GPCRs

  • Investigation of allosteric modulators of chemosensory function

  • Development of new tools for manipulating neural activity

These applications highlight the versatility of recombinant sra-31 as a research tool in neurobiology, offering insights into fundamental questions about sensory processing, neural development, and nervous system function .

How can recombineering approaches for sra-31 be adapted for high-throughput applications?

Adapting recombineering approaches for high-throughput applications with sra-31 involves several strategic modifications:

• Automation-Compatible Protocols:

  • Miniaturized reaction volumes for 96-well format

  • Robot-friendly liquid handling steps

  • Standardized DNA preparation methods

  • Parallel electroporation using multi-well electroporation devices

• Pooled Library Generation:

  • Design of barcoded homology arms for multiplexed modifications

  • Deep sequencing for identification of successful recombinants

  • FACS-based enrichment of desired phenotypes

  • Machine learning algorithms for prediction of recombination efficiency

• Streamlined Selection Methods:

  • Fluorescent protein-based selection without antibiotic markers

  • Dual reporter systems for identifying correct integrations

  • Automated colony picking and screening

  • Droplet microfluidics for single-cell analysis of recombinants

• Quality Control Metrics:

  • Internal control constructs to normalize efficiency across batches

  • Statistical process control charts to monitor recombination rates

  • Automated image analysis for colony screening

  • Standardized reporting of success rates for protocol optimization

These adaptations enable scaling from individual gene modifications to genome-wide studies, facilitating systematic functional analysis of sra-31 and related genes in diverse genetic backgrounds and conditions .

What are the key considerations for reproducing published research on sra-31?

Successfully reproducing published research on sra-31 requires careful attention to several critical factors that may not be fully detailed in methods sections:

• Strain Background Considerations:

  • Obtain the exact C. elegans strain used in the original study

  • Consider potential genetic drift in laboratory strains

  • Document complete genotype including marker mutations

  • Use freshly thawed stocks rather than long-maintained cultures

• Environmental Variable Standardization:

  • Temperature control (±0.5°C precision)

  • Media composition (source of peptone, agar, cholesterol)

  • Bacterial food source (strain, growth conditions, concentration)

  • Humidity and other environmental factors affecting behavior

• Experimental Protocol Nuances:

  • Timing of experiments relative to developmental stages

  • Precise details of buffer compositions and pH

  • Equipment specifications and calibration

  • Software versions for imaging and analysis

• Reporting Standards for Replication:

  • Document all deviations from published protocols

  • Report both successful and failed replication attempts

  • Provide raw data alongside analyzed results

  • Consider inter-laboratory validation for critical findings

By addressing these considerations systematically, researchers can enhance the reproducibility of sra-31 studies and contribute to a more robust understanding of this receptor's biology and function. This approach also facilitates meta-analysis across studies and accelerates scientific progress in the field .

How might future developments in protein engineering impact research on sra-31?

Emerging developments in protein engineering are poised to significantly impact sra-31 research in several transformative ways:

• Structure Determination Advances:

  • Cryo-EM techniques adapted for membrane proteins

  • Computational structure prediction using AlphaFold and related AI approaches

  • Novel crystallization methods for GPCRs

  • Hydrogen-deuterium exchange mass spectrometry for dynamic structural information

• Designer sra-31 Variants:

  • Directed evolution for enhanced expression or stability

  • Biosensor development through domain insertion of fluorescent proteins

  • Light-controllable variants incorporating photoswitchable amino acids

  • Split protein complementation systems for protein-protein interaction studies

• In Vivo Engineering Applications:

  • CRISPR base editing for precise amino acid substitutions without selection markers

  • Orthogonal translation systems for unnatural amino acid incorporation

  • Regulated degradation domains for temporal control of protein function

  • Tissue-specific expression optimization through synthetic promoter engineering

• Integration with Systems Biology:

  • Proteome-wide interaction mapping using proximity labeling

  • Metabolic engineering to identify natural ligands

  • Multi-omics integration to place sra-31 in signaling networks

  • Quantitative modeling of receptor dynamics and signal transduction