Recombinant Serpentine receptor class alpha-32 (sra-32)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format that we currently have in stock. However, if you have a specific format preference, please indicate your requirements when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributors.
Important note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us beforehand. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for a period of up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life of a protein is influenced by several factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. For lyophilized protein, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during our production process. If you have a specific tag type in mind, please inform us, and we will prioritize the development of the specified tag.
Synonyms
sra-32; B0304.5; Serpentine receptor class alpha-32; Protein sra-32
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-338
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
sra-32
Target Protein Sequence
MEDYAENSFNVIPISMEYIRDLRTATSFRVYVIYIDLVLILALFLSIHAIRELTSKQLFS KSITHLLIASLVYGNVHNASYTIIETWSLYRSFAYSDNMTAIMFTSEECFVQHVLNSCVR FLFIAIELALNVDRIIVILFRKHFHCYPGVRGEILNILAVILSFALGCLLHLKGPHPGIV TTSCFRETDITINLCSTNLTSYTILSACCAALDFLMMWYTWNDRKKINYDLNSQYLKVEQ HHSLMAVSLNSLLQLFVTSIYAISMFVLANMSMTNPELGNANLLRWFYTTPYSTLLVPIQ IKVFIQWIGNRRKRRINTATRVSLTQDGYFTKLSDSWK
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_B0304.5

STRING: 6239.B0304.5

UniGene: Cel.29551

Protein Families
Nematode receptor-like protein sra family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Structural and Functional Characteristics

Q: What are the key structural domains of the sra-32 protein?

A: The sra-32 protein contains multiple hydrophobic regions consistent with its classification as a serpentine receptor. Key structural features include:

  • N-terminal extracellular domain (approximately residues 1-45)

  • Multiple transmembrane domains with alpha-helical structure

  • Intracellular signaling regions containing potential phosphorylation sites

  • Conserved motifs typical of G-protein coupled receptors

These structural elements are crucial for its membrane localization and signaling functions in C. elegans .

Expression and Purification Considerations

Q: What expression systems are most suitable for recombinant production of sra-32?

A: For successful expression of recombinant sra-32, consider the following systems:

  • Bacterial systems: While cost-effective, they often result in inclusion bodies requiring refolding, which is challenging for multi-pass membrane proteins like sra-32.

  • Insect cell systems: Provide improved post-translational modifications and membrane protein folding compared to bacterial systems.

  • Mammalian cell systems: Offer optimal post-translational modifications but at higher cost and potentially lower yield.

When designing your expression strategy, include appropriate tags (His, GST, or FLAG) to facilitate purification while minimizing interference with protein function .

Q: What buffer conditions are optimal for maintaining sra-32 stability?

A: Based on recombinant protein handling principles, optimal buffer conditions for sra-32 include:

Buffer ComponentRecommended RangePurpose
Tris-HClpH 7.4-8.0pH stabilization
Glycerol20-50%Prevention of aggregation
NaCl150-300 mMIonic strength maintenance
Protease inhibitorsAs recommendedPrevention of degradation
Reducing agent1-5 mM DTT or β-MEMaintaining reduced cysteines

Storage at -20°C or -80°C is recommended for long-term storage, with working aliquots maintained at 4°C for up to one week to minimize freeze-thaw cycles .

Assay Development and Validation

Q: What experimental designs are most appropriate for studying sra-32 function?

A: When designing experiments to study sra-32 function, consider these approaches:

  • Factorial designs: Useful for simultaneously evaluating multiple factors affecting sra-32 activity (e.g., ligand concentration, pH, temperature). This approach allows for identification of interaction effects between variables.

  • Response surface methodology: Appropriate for optimizing assay conditions to maximize sra-32 activity or stability.

  • Fractional factorial designs: When resource constraints prevent testing all possible combinations, this approach selects a strategic subset of conditions.

Follow the structured process for experimental design:

Q: How should I validate antibodies for sra-32 detection in immunoassays?

A: Rigorous antibody validation is essential for sra-32 research. Follow this methodological approach:

  • Specificity testing: Compare signals between tissues/cells expressing sra-32 and negative controls (knockout or knockdown samples).

  • Cross-reactivity assessment: Test against related serpentine receptors to ensure specificity.

  • Validation across applications: Confirm functionality in multiple techniques (Western blot, immunohistochemistry, ELISA).

  • Epitope mapping: Determine which region of sra-32 is recognized, especially important if studying specific domains.

  • Lot-to-lot consistency: Test multiple antibody lots to ensure reproducibility.

Document these validation steps thoroughly in your methods section to enhance reproducibility .

ELISA-Based Detection Methods

Q: What are the critical parameters for developing an ELISA to detect recombinant sra-32?

A: When developing an ELISA for detecting recombinant sra-32, optimize these critical parameters:

  • Coating conditions: Determine optimal concentration of capture antibody (typically 1-10 μg/mL) and buffer conditions (carbonate buffer pH 9.6 vs. PBS pH 7.4).

  • Blocking protocol: Test different blocking agents (BSA, milk protein, commercial blockers) at various concentrations (1-5%) to minimize background.

  • Sample preparation: Optimize lysis buffers for protein extraction while preserving epitope integrity.

  • Detection system: Compare direct vs. sandwich ELISA formats, considering sensitivity requirements.

  • Standard curve: Prepare a dilution series of purified recombinant sra-32 protein for quantification.

Implement a systematic optimization approach by testing each parameter while keeping others constant, then validating the optimized protocol with appropriate controls .

Functional Characterization Strategies

Q: What approaches can be used to identify potential ligands of sra-32?

A: To identify potential ligands for sra-32, consider implementing these complementary methodologies:

  • Reporter cell-based assays: Express sra-32 in heterologous cells with appropriate G-protein coupled signaling reporters (calcium flux, cAMP production, or ERK phosphorylation) and screen candidate compounds.

  • Binding assays: Utilize radio-labeled or fluorescently-tagged potential ligands to assess direct binding to purified recombinant sra-32.

  • Computational approaches: Perform in silico screening based on the predicted structure of sra-32 binding pockets.

  • Genetic approaches in C. elegans: Create gain-of-function or loss-of-function mutants and assess phenotypic effects that might suggest ligand interactions.

These approaches should be used in combination for robust ligand identification, as each has complementary strengths and limitations .

Q: How can I incorporate quasi-experimental designs to study sra-32 in its native context?

A: When randomized controlled trials are not feasible for studying sra-32 in its native context, consider these quasi-experimental approaches:

  • Interrupted time series (ITS): Measure sra-32-related outcomes before and after a specific intervention, with multiple time points to establish trends.

  • Pre-post designs with non-equivalent control groups: Compare sra-32 expression or function in experimental vs. control C. elegans populations that weren't randomly assigned.

  • Stepped wedge designs: Implement interventions affecting sra-32 in a staggered fashion across different populations or conditions.

Be aware that these designs have limitations, particularly vulnerability to threats to internal validity and confounding factors. Mitigate these by:

  • Measuring and controlling for potential confounding variables

  • Using multiple control groups when possible

  • Implementing statistical adjustments to account for baseline differences

Data Analysis and Interpretation Challenges

Q: How should I address reproducibility issues in sra-32 functional studies?

A: To enhance reproducibility in sra-32 functional studies:

  • Standardize experimental protocols: Develop detailed SOPs covering expression systems, purification methods, storage conditions, and assay procedures.

  • Implement robust controls: Include positive controls (known functional variants), negative controls, and internal standards in each experiment.

  • Address batch effects: Use statistical methods to identify and correct for variation between experimental batches.

  • Validate across systems: Confirm key findings in multiple expression systems or model organisms.

  • Pre-register studies: Consider pre-registering experimental designs and analysis plans to reduce potential bias.

  • Share raw data: Make underlying data available to enable independent verification and meta-analysis.

A systematic approach to protocol development, coupled with rigorous validation across multiple systems, will significantly enhance reproducibility .

Leveraging Sequence and Structural Information

Q: How can I use existing bioinformatics resources to predict sra-32 function?

A: To leverage bioinformatics for sra-32 functional prediction:

  • Sequence homology analysis: Compare sra-32 sequence with related receptors of known function using tools like BLAST and Clustal Omega.

  • Structural prediction: Use tools like I-TASSER or AlphaFold to generate predicted 3D structures based on the sra-32 sequence (338 amino acids).

  • Domain annotation: Identify functional domains using resources like Pfam, SMART, or InterPro.

  • Evolutionary analysis: Perform phylogenetic analysis to place sra-32 in evolutionary context relative to functionally characterized family members.

  • Gene co-expression networks: Analyze C. elegans transcriptome datasets to identify genes co-expressed with sra-32, potentially revealing functional pathways.

This multi-faceted approach provides complementary lines of evidence for functional hypotheses that can be experimentally tested .

Q: How can metadata from sequence repositories enhance sra-32 research?

A: Metadata from sequence repositories can significantly enhance sra-32 research through:

  • Expression context identification: Mining BioSample metadata from SRA (Sequence Read Archive) can reveal tissues, developmental stages, and conditions where sra-32 is expressed.

  • Experimental design enrichment: Analysis of metadata attribute-value pairs can inform experimental design by identifying commonly investigated variables and conditions.

  • Comparative analysis: Extract species, sex, tissue, and molecular data type information from BioSample entries to enable cross-study comparisons.

  • Automated metadata extraction: Use machine learning approaches like recurrent neural networks to extract relevant metadata from free-text descriptions with high accuracy (85.2%) and AUROC (0.977).

Single-Subject and Longitudinal Study Designs

Q: What single-subject experimental designs are appropriate for studying sra-32 variability?

A: For investigating individual variability in sra-32 expression or function, consider these single-subject experimental designs:

  • Withdrawal designs (ABA designs): Implement an intervention affecting sra-32, withdraw it, then reimplement it to establish causality at the individual level.

  • Alternating treatment designs: Compare multiple interventions affecting sra-32 within the same subject over alternating time periods.

  • Multiple baseline designs: Introduce interventions at different times across multiple individuals or systems to control for time-related confounds.

Experimental Optimization Approaches

Q: How can I implement adaptive designs to optimize sra-32 expression conditions?

A: Implement these adaptive experimental design approaches to optimize sra-32 expression:

  • Sequential Multiple Assignment Randomized Trials (SMART): Design experiments where subsequent treatments are determined by responses to initial conditions. For example, if initial expression levels are low, randomize to different optimization strategies.

  • Response surface methodology (RSM): Use central composite or Box-Behnken designs to systematically explore the relationship between multiple factors (temperature, inducer concentration, media composition) and sra-32 expression.

  • Factorial optimization with interim analyses: Implement factorial designs with planned interim analyses to eliminate unpromising conditions early.

This table summarizes an example SMART design for sra-32 expression optimization:

StageResponseNext Randomization
Initial expression systemHigh expressionFine-tune purification
Initial expression systemLow expressionRandomize to: (1) Alternative promoter or (2) Alternative host
Alternative conditionImproved expressionOptimize induction parameters
Alternative conditionNo improvementTry fusion tag approach

These adaptive approaches can significantly reduce resource utilization while effectively converging on optimal conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.