Recombinant Serpentine receptor class beta-15 (srb-15)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
srb-15; C48B6.5; Serpentine receptor class beta-15; Protein srb-15
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-336
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
srb-15
Target Protein Sequence
MTEISEICETAFKLTYHPIYRGSLFIHLFVSISSIIPLIYFVIFKLPKTSFHGNLKFLFS AYFVSVFLFSVDFAIISTTEILIPLFSKHPCNLLIPDQYLKIGNTTVSIFMSLSTFFPIS ITIERFIAMKMARTYEKTRVRLGPILTGCNILLDLLIVFFIYRDEKFDDGSISFVFFPKT LAPKMFTFFWVMFFLNLINFTFNSYLLRQSIRLKVSTSSLATKYQREEVVHSTKFAVFVV FCHVILFGFYVIGIMILRYFGSIFIPDPADLMATRGAFTTMISLYNLVVGSVAVYLNHLI KTRKSEEITGTVRIQATGAVGAQNYENAIFNIWNSV
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_C48B6.5

UniGene: Cel.26120

Protein Families
Nematode receptor-like protein srb family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Serpentine receptor class beta-15 (srb-15) and how does it fit within the GPCR superfamily?

Serpentine receptor class beta-15 (srb-15) belongs to the G-protein coupled receptor (GPCR) superfamily, which constitutes the largest group of cell-surface proteins in the human genome. GPCRs are classified into four main families based on characteristic protein sequences and structural similarities: the rhodopsin family (Class-A), the secretin and adhesion family (Class-B), the glutamate family (Class-C), and the Frizzled/Smoothened family (Class-F) . As a serpentine receptor, srb-15 contains the characteristic seven-transmembrane domain structure that defines this receptor class. Understanding srb-15's classification provides important context for experimental design, as expression systems and purification strategies often need to be tailored to specific GPCR subfamilies.

What are the current limitations in recombinant production of serpentine receptors like srb-15?

Serpentine receptors, including srb-15, present significant challenges for recombinant production due to their complex membrane-spanning topology. Traditional expression systems often result in protein misfolding, aggregation, or insufficient yields. For example, studies with other GPCRs have shown that while high expression levels can sometimes be achieved (up to 2 mg/mL in cell-free systems), the resulting proteins may exhibit incorrect tertiary structure . This is evidenced by observations where cell-free produced receptors showed non-competitive binding to their ligands compared to receptors produced in cellular systems . NMR spectroscopy data, particularly 1H-13C HMQC SOFAST spectra of labeled receptors, often reveal disrupted tertiary structure in cell-free produced samples . These limitations necessitate careful optimization of expression systems and validation of proper folding before proceeding with functional studies.

How do cell-free protein synthesis (CFPS) systems compare to traditional expression systems for producing srb-15?

Cell-free protein synthesis (CFPS) has emerged as an alternative approach for producing challenging membrane proteins like srb-15. When comparing CFPS to traditional cellular expression systems:

ParameterCFPS (E. coli-based)Traditional Cellular Expression
YieldUp to 2 mg/mLTypically lower, variable
Time requiredHours (rapid)Days to weeks
Secondary structure formationGenerally correctGenerally correct
Tertiary structure integrityOften compromisedMore likely to be correct
Ligand binding propertiesMay show non-competitive bindingCompetitive binding preserved
ScalabilityEasily scalableMore complex scaling process

Research with thermostable GPCRs (like en2NTS1) demonstrates that while CFPS can produce high protein yields with correct secondary structure, the tertiary structure is often compromised as evidenced by non-competitive ligand binding and disrupted NMR spectra . For srb-15 production, researchers should carefully validate the structural integrity of CFPS-produced protein before proceeding with functional studies, possibly by comparing binding properties with traditionally expressed receptor samples.

What are the most effective detergents and lipid environments for stabilizing recombinant srb-15?

The choice of detergent and lipid environment is critical for maintaining the native conformation of serpentine receptors like srb-15. Though specific optimization for srb-15 would be necessary, research with other GPCRs provides valuable guidance:

  • Initial Screening: Test a panel of detergents including:

    • Mild detergents: DDM (n-dodecyl-β-D-maltopyranoside), LMNG (lauryl maltose neopentyl glycol)

    • Zwitter-ionic detergents: CHAPS, Fos-choline series

    • Mixed micelles: Bicelles composed of DMPC/CHAPSO

  • Lipid Supplementation: Addition of cholesterol hemisuccinate (CHS) or specific phospholipids often enhances stability.

  • Validation Approach: Monitor receptor stability using:

    • Ligand binding assays comparing competitive binding profiles

    • Thermal stability assays (CPM or nanoDSF)

    • Size exclusion chromatography to assess monodispersity

The optimal conditions must be determined empirically, as even closely related receptors can have different requirements. Researchers should systematically evaluate multiple conditions using functional and structural assays to identify optimal stabilization conditions for srb-15.

What approaches can be used to validate the correct folding of recombinant srb-15?

Validating correct folding of recombinant srb-15 requires multiple complementary approaches:

  • Ligand Binding Assays:

    • Surface plasmon resonance (SPR) using a Biacore system can determine binding kinetics and affinities

    • Comparative analysis between different expression systems (e.g., CFPS vs. cellular expression)

    • Competition assays to verify specific binding sites

  • Spectroscopic Methods:

    • Circular dichroism (CD) to confirm secondary structure elements

    • Nuclear magnetic resonance (NMR) spectroscopy, particularly 1H-13C HMQC SOFAST experiments with 13CH3-methionine labeled protein to assess tertiary structure integrity

  • Thermal Stability Assays:

    • Differential scanning fluorimetry with ligands to assess thermal shifts

    • CPM (7-diethylamino-3-(4-maleimidophenyl)-4-methylcoumarin) assays to monitor unfolding

Correct folding is indicated by competitive ligand binding, characteristic spectroscopic signatures, and enhanced thermal stability in the presence of specific ligands. For example, properly folded GPCRs typically show distinct methionine NMR signals, while misfolded variants display disrupted spectra similar to those observed with cell-free produced en2NTS1 .

How can I distinguish between monomeric and oligomeric states of srb-15, and what is their functional significance?

Determining the oligomeric state of srb-15 is crucial for understanding its functional properties. Multiple analytical approaches should be employed:

  • Size Exclusion Chromatography (SEC):

    • Analytical-grade columns can separate monomers from higher-order oligomers

    • Multi-angle light scattering (SEC-MALS) provides absolute molecular weight determination

    • Example workflow: Proteins should achieve >99% monomer purity for reliable functional studies, similar to approaches used for antibody fragments

  • Native PAGE and Blue Native PAGE:

    • Provides separation under non-denaturing conditions

    • Can resolve different oligomeric states

  • Functional Correlation:

    • Compare signaling properties of different oligomeric states

    • Monomer-stabilizing mutations can help assess function of specific states

The oligomeric state may significantly impact signaling properties, as seen with other receptors where dimerization can enhance or inhibit signaling. For example, in studies with LRP6 receptors, strictly monomeric antibody fragments (Fab) were distinguished from potential dimeric forms using analytical SEC to ensure >99% monomer content before functional analysis . This rigorous approach revealed that certain monovalent antibody fragments can modulate receptor activity without inducing dimerization, challenging previous assumptions about activation mechanisms .

What methods can be used to identify and characterize ligands of recombinant srb-15?

Several complementary approaches can be employed to identify and characterize srb-15 ligands:

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified srb-15 using tag-capture approaches (e.g., anti-FLAG antibody capture)

    • Inject potential ligands at increasing concentrations (typically 1-50 nM range)

    • Apply single-cycle kinetics method at controlled temperature (25°C)

    • Monitor association (3 minutes) and dissociation (5 minutes)

    • Fit data to 1:1 Langmuir binding model to determine kon, koff, and KD values

  • ELISA-Based Binding Assays:

    • Coat microplates with receptor-Fc fusion constructs (1-2 μg/ml in bicarbonate buffer, pH 9.5)

    • Block with BSA (5%)

    • Add potential ligands and detect binding using antibodies against ligand tags

    • Develop using appropriate secondary antibodies and detection systems

  • Cellular Signaling Assays:

    • Reporter gene assays (e.g., luciferase-based systems)

    • Measurement of second messengers (cAMP, Ca2+, IP3)

    • Phosphorylation of downstream effectors

The combination of these approaches provides complementary data on binding affinity, kinetics, and functional consequences, enabling comprehensive characterization of ligand interactions with srb-15.

How can I develop receptor-selective ligands to distinguish srb-15 signaling from related receptors?

Developing receptor-selective ligands requires a systematic approach:

  • Computational Design Strategy:

    • Generate structural models of srb-15 and related receptors

    • Perform in silico docking with candidate ligands

    • Identify regions with sequence divergence that could confer selectivity

    • Design variants with predicted selective binding properties

  • Experimental Validation Pipeline:

    • Express receptor-Fc fusion constructs of srb-15 and related receptors

    • Establish binding assays (ELISA, SPR) to test selectivity of ligand variants

    • Validate binding selectivity across multiple receptor family members

  • Functional Selectivity Assessment:

    • Compare activity in signaling assays specific to each receptor

    • Test cross-reactivity with a panel of related receptors

This approach has proven successful in developing selective ligands for other receptor systems. For example, receptor-selective variants of APRIL were successfully developed to distinguish between its receptors BCMA and TACI . The selective variants showed specific binding in both ELISA and SPR assays, and demonstrated functional selectivity in cellular assays . Similar strategies could be applied to develop srb-15-selective ligands, enabling precise dissection of its signaling pathways.

How can I use antibody-based approaches to modulate srb-15 function in research applications?

Antibody-based modulation of srb-15 function can be achieved through several sophisticated approaches:

  • Generation of Function-Modulating Antibodies:

    • Use phage display libraries to identify antibodies that bind specific domains of srb-15

    • Screen for functional effects (antagonism or agonism)

    • Classify antibodies based on their binding epitopes and functional effects

  • Engineering Antibody Formats for Specific Functions:

    • Monovalent formats (Fab fragments) to avoid receptor cross-linking

    • Biparatopic antibodies combining different binding specificities to achieve novel functions

    • IgG formats when receptor clustering may be desirable

  • Validation Approaches:

    • Compare effects in reporter gene assays

    • Assess receptor phosphorylation in response to antibody binding

    • Evaluate target gene expression (e.g., using qPCR for genes like Axin2)

Research with LRP6 receptor antibodies demonstrates how different antibody formats can produce distinct functional outcomes. For instance, certain monovalent Fab fragments can sensitize cells to specific ligands without causing receptor dimerization, while biparatopic antibodies can simultaneously block multiple ligand classes without showing agonistic activity . These sophisticated approaches can be adapted to develop srb-15-specific antibodies with precisely defined functional properties.

What are the current approaches for studying srb-15 in native membrane environments versus reconstituted systems?

Studying srb-15 in different membrane contexts requires specialized methodologies:

SystemAdvantagesLimitationsKey Techniques
Native membranesPhysiological lipid composition and protein interactionsComplex background; limited control- Fluorescence microscopy with tagged receptors
- Proximity labeling (BioID, APEX)
- Native immunoprecipitation
Reconstituted systemsDefined composition; controlled environmentMay lack important cofactors- Nanodiscs (MSP or SMALP-based)
- Proteoliposomes
- Supported lipid bilayers
Hybrid approachesBalance of native context and experimental controlTechnical complexity- Native nanodiscs
- Cell-derived vesicles with recombinant protein

For optimal characterization, researchers should combine multiple approaches. For example, initial characterization in reconstituted systems (nanodiscs or proteoliposomes) with purified components can establish basic functional properties, while subsequent studies in native membranes can validate physiological relevance. This multi-system approach has proven valuable for other GPCRs, revealing how membrane composition influences receptor conformation, ligand binding properties, and signaling outcomes.

What are the most common issues encountered when working with recombinant srb-15, and how can they be resolved?

Researchers commonly encounter several challenges when working with recombinant srb-15:

  • Low Expression Yields:

    • Problem: Insufficient protein production in traditional expression systems

    • Solution: Explore alternative systems like cell-free protein synthesis, which can achieve yields up to 2 mg/mL for GPCRs

    • Validation: Quantify protein using Western blotting with appropriate standards

  • Incorrect Folding:

    • Problem: Protein adopts non-native conformation despite high yield

    • Solution: Optimize detergent/lipid conditions and compare binding properties to receptors expressed in native systems

    • Validation: Perform 1H-13C HMQC SOFAST NMR spectroscopy with labeled protein to assess tertiary structure integrity

  • Aggregation Issues:

    • Problem: Protein forms aggregates during purification

    • Solution: Utilize analytical size-exclusion chromatography to confirm monomeric state (>99% purity)

    • Validation: Perform functional assays with size-fractionated protein to correlate function with oligomeric state

  • Non-specific Binding in Assays:

    • Problem: High background in binding assays

    • Solution: Implement rigorous blocking protocols (e.g., 5% BSA) and include appropriate controls

    • Validation: Compare binding profiles with well-characterized receptors

Each issue requires systematic troubleshooting and validation using multiple complementary techniques to ensure high-quality, functionally relevant recombinant srb-15 for research applications.

How can I establish quality control criteria for recombinant srb-15 preparations?

Establishing rigorous quality control criteria is essential for reproducible research with recombinant srb-15:

  • Purity Assessment:

    • SDS-PAGE with Coomassie staining (>90% purity)

    • Western blotting with receptor-specific and tag-specific antibodies

    • Mass spectrometry for identity confirmation

  • Structural Integrity Verification:

    • Circular dichroism to confirm secondary structure

    • Thermal stability assays (e.g., nanoDSF)

    • NMR spectroscopy to assess tertiary structural elements

  • Functional Validation:

    • Ligand binding assays with known ligands

    • SPR to determine binding kinetics and affinity constants

    • Comparison of key parameters across multiple preparations

  • Stability Monitoring:

    • Size-exclusion chromatography to track monodispersity over time

    • Activity assays after storage under different conditions

    • Freeze-thaw stability assessment

The minimum acceptance criteria should include: >90% purity by SDS-PAGE, >80% monodispersity by SEC, consistent binding parameters across preparations (KD values within 2-fold), and stability under standard storage conditions for at least one week. Implementing these criteria ensures that experimental results reflect the true properties of srb-15 rather than artifacts of sample preparation.

How can cryo-EM approaches be optimized for structural studies of recombinant srb-15?

Cryo-electron microscopy (cryo-EM) has revolutionized structural studies of membrane proteins, offering new opportunities for srb-15 research:

  • Sample Preparation Optimization:

    • Test multiple membrane mimetics (nanodiscs, amphipols, detergent micelles)

    • Utilize GraFix technique for gentle fixation and improved particle orientation

    • Implement on-grid affinity capture strategies for homogeneous samples

  • Data Collection Strategies:

    • Employ beam-tilt data collection to increase throughput

    • Implement motion correction algorithms for improved resolution

    • Use phase plate technology for enhanced contrast of smaller particles

  • Computational Analysis Approaches:

    • Apply 3D variability analysis to capture conformational heterogeneity

    • Implement focused classification for flexible domains

    • Utilize multi-body refinement for domains with independent movements

While obtaining high-resolution structures remains challenging for many serpentine receptors, cryo-EM offers advantages for capturing functional states without crystallization constraints. Combining cryo-EM with complementary techniques like hydrogen-deuterium exchange mass spectrometry (HDX-MS) and molecular dynamics simulations can provide comprehensive structural insights into srb-15 function.

What are the latest approaches for studying recombinant srb-15 in live-cell contexts?

Advanced live-cell imaging and functional approaches offer powerful tools for studying srb-15 in cellular contexts:

  • Biosensor Development:

    • FRET/BRET-based sensors to monitor conformational changes

    • Split-luciferase complementation for protein-protein interactions

    • Fluorescent ligands for real-time binding studies

  • Advanced Microscopy Techniques:

    • Single-molecule tracking to monitor receptor diffusion and clustering

    • Super-resolution microscopy (PALM/STORM) for nanoscale organization

    • Lattice light-sheet microscopy for extended 3D imaging with reduced phototoxicity

  • Genome Engineering Approaches:

    • CRISPR-Cas9 knock-in of fluorescent tags at endogenous loci

    • Conditional expression systems for temporal control

    • Cell-type specific expression in complex tissues

  • Quantitative Analysis Frameworks:

    • Single-particle tracking and diffusion analysis

    • Spatial statistics for receptor organization

    • Integration with computational modeling

These approaches enable researchers to bridge the gap between in vitro biochemical studies and physiological function, providing insights into srb-15 dynamics, interactions, and signaling in the complex cellular environment. The combination of recombinant technologies with advanced imaging creates powerful platforms for dissecting receptor function with unprecedented spatial and temporal resolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.