Recombinant Serpentine receptor class beta-18 (srb-18)

Shipped with Ice Packs
In Stock

Description

Introduction to Serpentine Receptor Class Beta-18

Serpentine Receptor Class Beta-18 (srb-18) is a protein encoded by the srb-18 gene in Caenorhabditis elegans, a model organism widely used in biological research. The protein is classified as a serpentine receptor, which belongs to the G protein-coupled receptor (GPCR) superfamily characterized by their distinctive seven-transmembrane domain structure. In C. elegans, serpentine receptors play crucial roles in chemosensation and other sensory functions that allow the organism to interact with its environment .

The recombinant form of srb-18 protein has been developed for research purposes, allowing scientists to study its structure, function, and potential applications in various biological contexts. The availability of high-quality recombinant protein preparations has significantly advanced our understanding of this receptor and facilitated studies that would otherwise be challenging with naturally occurring proteins extracted from C. elegans.

Protein Structure and Composition

The full-length serpentine receptor class beta-18 consists of 363 amino acids (residues 1-363) and belongs to the broader family of G protein-coupled receptors characterized by their seven-transmembrane domain architecture . This receptor structure is highly conserved across species and plays a fundamental role in transmembrane signaling processes.

For research applications, recombinant srb-18 protein is typically expressed with a histidine tag (His-tag) at the N-terminus, which facilitates purification and detection without significantly affecting the protein's native structure and function. The recombinant protein is produced using bacterial expression systems, particularly Escherichia coli, which allows for cost-effective and scalable production .

Gene Information and Synonyms

The srb-18 protein is encoded by the srb-18 gene, also known by the systematic name C54F6.7 in the C. elegans genome. In scientific literature and databases, this protein may be referenced under several synonyms including "Serpentine receptor class beta-18" and "Protein srb-18" . The protein is cataloged in the UniProt database with the identifier O16444, providing a standardized reference point for researchers studying this protein.

Expression Systems

The recombinant srb-18 protein is typically produced using bacterial expression systems, with E. coli being the preferred host organism due to its well-established genetic tools, rapid growth, and high protein yield capabilities . For the production of functional srb-18, specialized E. coli strains optimized for recombinant protein expression are employed to ensure proper folding and minimal degradation.

Purification and Tagging

For efficient purification and detection, recombinant srb-18 is typically expressed with an N-terminal histidine tag (His-tag). This affinity tag allows for selective purification using immobilized metal affinity chromatography (IMAC), where the His-tagged protein binds to metal ions (typically nickel or cobalt) immobilized on a solid support. After washing away non-specifically bound proteins, the purified srb-18 can be eluted using imidazole or pH changes .

The final product is typically supplied as a lyophilized powder with a purity greater than 90% as determined by SDS-PAGE analysis. This high-purity preparation is essential for downstream applications requiring specific and reliable protein-protein interactions or functional studies .

Reconstitution Protocols

Prior to use, the lyophilized srb-18 protein should be briefly centrifuged to bring the contents to the bottom of the vial. Reconstitution is recommended in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

For long-term stability of the reconstituted protein, the addition of glycerol to a final concentration of 5-50% is recommended, with 50% being the standard for extended storage at -20°C or -80°C. The glycerol acts as a cryoprotectant, preventing ice crystal formation that could damage the protein structure during freezing .

Functional Studies in C. elegans Biology

As a member of the serpentine receptor family in C. elegans, srb-18 likely plays important roles in chemosensation and other sensory functions. Research on serpentine receptors in C. elegans has revealed their involvement in detecting environmental cues related to food sources, potential mates, and harmful substances. The availability of purified recombinant srb-18 allows for detailed investigations into its specific ligand binding properties and downstream signaling pathways.

While the specific function of srb-18 has not been extensively characterized compared to some other serpentine receptors, its study may provide insights into the broader functional diversity of this receptor family in C. elegans. This is particularly relevant given that C. elegans has an unusually large number of serpentine receptors for its relatively simple nervous system, suggesting specialized roles for individual receptor subtypes.

Comparative Studies with Related Proteins

The C. elegans genome contains numerous genes encoding serpentine receptors, and comparative studies between different members of this family can reveal evolutionary relationships and functional specializations. In this context, the availability of recombinant srb-18 facilitates comparative biochemical and structural analyses.

Interestingly, while studying protein expression patterns in C. elegans, researchers have noted that some proteins show restricted expression patterns, while others are more ubiquitously expressed. For example, UNC-18, a protein involved in synaptic transmission, is primarily expressed in the nervous system of C. elegans, while a paralog named UNCP-18 shows ubiquitous expression . Similar comparative analyses of expression patterns for srb-18 and related receptors could provide valuable insights into their specialized functions in different tissues.

Antibody Production and Immunological Applications

Purified recombinant srb-18 protein can serve as an antigen for the production of specific antibodies. These antibodies are valuable tools for detecting and localizing the native protein in C. elegans tissues using techniques such as immunohistochemistry, immunofluorescence, and Western blotting. Such studies can reveal the spatial and temporal expression patterns of srb-18, providing clues about its physiological functions.

Additionally, anti-srb-18 antibodies could be used in co-immunoprecipitation experiments to identify protein-protein interactions, potentially uncovering the components of signaling pathways involving this receptor.

Protein Characteristics

CharacteristicDetails
Molecular WeightApproximately 40-45 kDa (including His-tag)
Isoelectric Point (pI)Predicted to be in the range of 6.5-7.5
Structural FeaturesSeven transmembrane domains characteristic of GPCRs
Synonymssrb-18; C54F6.7; Serpentine receptor class beta-18; Protein srb-18
UniProt IDO16444

Table 2: Physical and chemical characteristics of srb-18 protein .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing the order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development if possible.
Synonyms
srb-18; C54F6.7; Serpentine receptor class beta-18; Protein srb-18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-363
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
srb-18
Target Protein Sequence
MTSEEIHAAGLCSVVPTIFQNCDNDWISKNGTCYQDSCCMSLETATSWYYRLAQFSHVVF SFMGLIIVVVYILRYRSRHILPENVRVLVDFMLLFIVAHSIDMIVLHIYHIIQSFQANIS DPCFVREKVSFCAPFRYTFSFCSMGLAICTYCIYIDRLACAYYKNYTKHQRLILAAQICQ LIVISSLIIIWVYRNEEPNTYLLSCLNVPVASVEDMAKATIAVFPINFICFFLSIGLFRH FKKKEEGSRFDIVRHFTASVDVESSEFLFRTTGTQAALMALFSVASLLMRLVYNFLPRQV GLTIATLSYIMSIYCFTVPLVIVKCVQKTSALRKSRISSHVGLKAMGVEGASNYFEMMKS QWE
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_C54F6.7

UniGene: Cel.4372

Protein Families
Nematode receptor-like protein srb family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Serpentine receptor class beta-18 (srb-18)?

Serpentine receptor class beta-18 (srb-18) is a G-protein coupled receptor (GPCR) found in Caenorhabditis elegans. It belongs to the rhodopsin-like GPCR superfamily and is characterized by its seven-transmembrane domain structure. The full-length protein consists of 363 amino acids and is identified in the UniProt database with the accession number O16444 . The protein functions as a membrane-bound receptor involved in signal transduction pathways, similar to other GPCRs which transduce extracellular signals into intracellular responses.

How is recombinant srb-18 typically produced for research applications?

Recombinant srb-18 for research applications is typically produced using heterologous expression systems. The protein is expressed with tags to facilitate purification and detection. According to available product information, recombinant srb-18 is commonly stored in Tris-based buffer with 50% glycerol to maintain stability .

The production methodology typically follows these steps:

  • Cloning of the srb-18 gene into an appropriate expression vector

  • Transformation of host cells (commonly E. coli, yeast, or insect cells)

  • Induction of protein expression

  • Cell lysis and protein extraction

  • Affinity chromatography purification based on the included tag

  • Quality control testing including SDS-PAGE and Western blotting

For optimal stability, the purified protein should be stored at -20°C for short-term or -80°C for long-term storage, with repeated freeze-thaw cycles avoided to maintain protein integrity .

How does srb-18 compare structurally and functionally to other serpentine receptors?

Serpentine receptor class beta-18 belongs to a larger family of GPCRs, with structural and functional similarities to other serpentine receptors. Analysis of serpentine receptor domains has identified at least thirteen proteins in this class . When comparing these receptors:

Structural Comparisons:

  • Like other GPCRs, srb-18 possesses the characteristic seven-transmembrane domain architecture

  • Sequence alignment studies suggest that the greatest variation between serpentine receptors occurs in the extracellular loops, which are likely involved in ligand recognition and binding specificity

  • The intracellular domains show higher conservation, reflecting their shared role in G-protein coupling

Functional Comparisons:

  • Similar to other GPCRs, srb-18 likely participates in signal transduction pathways, though its specific ligands and downstream effectors require further characterization

  • Experimental approaches used to study GPCRs, such as bioluminescence resonance energy transfer (BRET) and fluorescence resonance energy transfer (FRET), have revealed that many GPCRs form homodimers or heterodimers, which can affect their signaling properties

Research has demonstrated that some rhodopsin-like GPCRs exhibit negative cooperativity upon homodimerization, a phenomenon that might also apply to srb-18, though specific studies on srb-18 dimerization are currently limited .

What experimental approaches are most effective for studying srb-18 dimerization and signaling?

Several experimental approaches have proven effective for studying GPCR dimerization and signaling, which can be applied to srb-18 research:

Biophysical Methods for Dimerization Studies:

  • Bioluminescence Resonance Energy Transfer (BRET): This technique involves tagging srb-18 with Renilla luciferase (RLuc) as a donor and Enhanced Yellow Fluorescent Protein (EYFP) as an acceptor. The intensity of the generated signal depends on the distance between the donor and acceptor and their relative orientation, making it an effective method for detecting protein-protein interactions .

  • Fluorescence Resonance Energy Transfer (FRET): FRET allows visualization of protein-protein interactions at the subcellular level in living cells. This method is particularly valuable for determining the localization of interactions within the cell .

Competition Experiments:
To confirm the specificity of observed interactions, competition experiments can be conducted by co-transfecting:

  • A constant ratio of tagged srb-18 (srb-18-EYFP and srb-18-RLuc)

  • Increasing amounts of untagged wild-type srb-18 or an unrelated receptor as a control

  • Measuring the net BRET signals to determine if the untagged srb-18 competes with the tagged versions

Limitations to Consider:

  • BRET technology requires transfection of chimeric constructs, limiting exploration of native systems

  • It doesn't discriminate between signals generated intracellularly or at the cell surface

  • Alternative methods like co-immunoprecipitation may be needed to validate interactions

What is known about the signaling pathways downstream of srb-18 activation?

While specific information about srb-18 signaling is limited in the provided search results, insights can be drawn from studies of similar GPCRs:

Based on research on other GPCRs such as GPR180 in Plasmodium, signaling pathways likely involve:

  • cGMP-Protein Kinase G (PKG) Signaling: Upon activation, GPCRs like GPR180 have been shown to modulate intracellular cGMP levels, which then activate PKG .

  • Calcium Mobilization: Following GPCR activation, cytosolic Ca²⁺ mobilization is a common downstream effect, which can be measured to assess receptor function .

  • Small GTPase Interactions: Some GPCRs interact with small GTPases, such as Rab6, which are involved in various cellular processes including vesicular trafficking .

Proposed Experimental Design for srb-18 Signaling Studies:

Experimental ApproachMeasurementExpected Outcome for Active Signaling
cGMP AssayIntracellular cGMP levelsElevation upon receptor activation
Calcium ImagingCytosolic Ca²⁺ concentrationRapid increase followed by plateau
Co-immunoprecipitationProtein-protein interactionsDetection of associated G-proteins and downstream effectors
Transcriptome AnalysisGene expression changesAltered expression of genes involved in cyclic nucleotide signaling

To properly characterize srb-18 signaling, knockout/knockdown studies would be valuable to observe phenotypic changes and altered signaling dynamics, similar to approaches used with other GPCRs .

What are the best experimental designs for studying srb-18 function in Caenorhabditis elegans?

To effectively study srb-18 function in C. elegans, researchers should consider the following experimental designs:

Genetic Manipulation Approaches:

  • CRISPR-Cas9 Gene Editing: This allows precise modification of the srb-18 gene to create knockout or knockin models, enabling functional studies through phenotypic analysis.

  • RNAi Knockdown: A less permanent but more rapid approach to reduce srb-18 expression and observe resulting phenotypes.

Experimental Design Considerations:
When designing experiments to study srb-18 function, block-randomized experimental designs can be particularly effective. In this approach:

  • Homogeneous sets of worms are grouped into blocks based on relevant covariates

  • This grouping ideally places together organisms with similar potential outcomes

  • Treatments are then randomized within these blocks

The strength of this design lies in its ability to reduce variance and increase precision, particularly when blocking variables are strongly correlated with potential outcomes. This is especially relevant for C. elegans studies, where factors like developmental stage, genetic background, and environmental conditions can significantly influence experimental outcomes .

For Advanced Functional Studies:
Factorial experiments can be employed when studying how srb-18 interacts with other signaling components:

  • Multiple treatments can be randomly assigned (e.g., srb-18 manipulation combined with manipulations of potential downstream effectors)

  • This allows for the estimation of interaction effects between different treatments

  • The prototypical design would be a "two-by-two" factorial design examining how srb-18 status interacts with another factor

What protein interaction methods are most suitable for identifying srb-18 binding partners?

Several methods can be employed to identify srb-18 binding partners, each with distinct advantages:

1. Co-Immunoprecipitation (Co-IP) with Affinity Tags:

  • Express recombinant srb-18 with affinity tags (as available from commercial sources)

  • Use the tag to pull down srb-18 along with interacting proteins

  • Identify binding partners through mass spectrometry

  • This approach is particularly useful for detecting stable interactions

2. Proximity-Based Labeling:

  • BioID or APEX2 fusion proteins can be created with srb-18

  • These enzymes biotinylate proteins in close proximity to srb-18

  • Biotinylated proteins can then be purified and identified

  • This method captures both stable and transient interactions in the native cellular environment

3. BRET/FRET-Based Interaction Studies:
For testing specific hypothesized interactions:

  • Create fusion proteins of srb-18 and potential interactors with appropriate BRET/FRET pairs

  • Measure energy transfer as an indicator of protein proximity

  • Include proper controls to confirm specificity, such as competition experiments with untagged constructs

Validation Protocol:
To ensure the reliability of identified interactions, a multi-method validation approach is recommended:

  • Initial screening with high-throughput methods (e.g., yeast two-hybrid or proximity labeling)

  • Validation of top candidates with orthogonal methods (e.g., co-IP, BRET/FRET)

  • Functional validation through genetic manipulation and phenotypic analysis

This comprehensive approach minimizes false positives and establishes biological relevance of the interactions.

How can researchers effectively troubleshoot recombinant srb-18 expression and purification issues?

When working with recombinant srb-18, researchers often encounter expression and purification challenges. Here are methodological solutions to common issues:

Expression Troubleshooting:

IssuePotential SolutionRationale
Low expression levelTry different expression systems (E. coli, yeast, insect cells)Membrane proteins like srb-18 often express better in eukaryotic systems
Protein insolubilityInclude detergents during extraction (e.g., DDM, CHAPS)Helps solubilize membrane-embedded regions
Protein degradationAdd protease inhibitors; optimize induction conditionsReduces proteolytic degradation during expression
Inclusion body formationLower expression temperature; use solubility-enhancing tagsSlows protein synthesis to allow proper folding

Purification Optimization:

  • Detergent Screening: Test a panel of detergents to identify optimal conditions for extracting functional srb-18 from membranes.

  • Tag Selection: The tag type should be determined during the production process to optimize for both yield and function . Common options include:

    • His-tag for metal affinity chromatography

    • GST-tag for improved solubility and affinity purification

    • MBP-tag to enhance solubility of difficult membrane proteins

  • Storage Conditions: Proper storage is crucial for maintaining protein stability:

    • Store in Tris-based buffer with 50% glycerol

    • Maintain at -20°C for regular use or -80°C for long-term storage

    • Avoid repeated freeze-thaw cycles by preparing working aliquots stored at 4°C for up to one week

  • Quality Control: Verify protein integrity through:

    • SDS-PAGE to confirm size and purity

    • Western blotting to verify identity

    • Circular dichroism to assess secondary structure

    • Functional assays to confirm biological activity

How should researchers analyze data from srb-18 receptor signaling experiments?

Analyzing data from srb-18 receptor signaling experiments requires careful consideration of statistical approaches and experimental design. Based on established practices for GPCR research:

Statistical Analysis Framework:

For causal inference in experimental designs involving srb-18 signaling, the following framework is recommended:

Recommended Analysis Approaches:

  • For Concentration-Response Data:

    • Fit data to appropriate models (e.g., four-parameter logistic regression)

    • Compare EC50 values and efficacy parameters

    • Use statistical tests (t-tests, ANOVA) to assess significance of differences

  • For Time-Course Signaling Data:

    • Analyze both magnitude and kinetics of response

    • Consider area under the curve (AUC) for cumulative response

    • Apply appropriate time-series analysis methods

  • For Receptor Dimerization Studies:

    • Calculate net BRET or FRET signals

    • Plot titration curves (signal vs. expression level)

    • Perform specificity tests through competition experiments with untagged constructs

What are the most common sources of contradictory results in srb-18 research, and how can they be addressed?

Contradictory results in GPCR research, including studies on srb-18, can arise from various sources. Understanding and addressing these contradictions is crucial for advancing the field:

Common Sources of Contradictions:

Recommended Approach for Resolving Contradictions:

Create a comparison table of contradictory findings that includes:

  • Experimental system used

  • Protein constructs (tags, mutations)

  • Measurement methods

  • Sample sizes and statistical approaches

  • Key controlled variables

This systematic approach can reveal patterns in the contradictions and point to the underlying methodological differences causing discrepancies.

How can computational modeling enhance our understanding of srb-18 structure and function?

Computational modeling offers powerful approaches for understanding srb-18 structure and function, particularly given the challenges of working with membrane proteins experimentally:

Structure Prediction and Analysis:

  • Homology Modeling:

    • Identify structural templates among solved GPCR structures

    • Align srb-18 sequence with template sequences

    • Build and refine 3D models

    • Validate models using energy minimization and Ramachandran plots

  • Molecular Dynamics Simulations:

    • Embed the modeled srb-18 structure in a lipid bilayer

    • Simulate protein dynamics in a physiologically relevant environment

    • Analyze conformational changes and stability

    • Identify potential ligand binding sites and allosteric pockets

Functional Prediction:

  • Protein-Protein Interaction Prediction:

    • Use docking algorithms to predict interactions with G-proteins and other signaling partners

    • Identify key residues at interaction interfaces

    • Generate testable hypotheses about functional domains

  • Signaling Pathway Modeling:

    • Develop mathematical models of srb-18 signaling pathways

    • Incorporate experimental data on signaling kinetics

    • Simulate pathway behaviors under various conditions

    • Predict system responses to perturbations

Integration with Experimental Data:

For optimal results, computational approaches should be integrated with experimental data in an iterative process:

Computational ApproachExperimental ValidationOutcome
Structure predictionSite-directed mutagenesisValidation of key structural elements
Binding site predictionLigand binding assaysConfirmation of predicted binding pockets
Protein-protein interaction modelingCo-immunoprecipitationVerification of predicted interactions
Signaling pathway simulationMeasurement of signaling kineticsRefinement of pathway models

This integrated approach allows researchers to generate and test hypotheses more efficiently, accelerating progress in understanding srb-18 function.

What are the most promising applications of srb-18 research in understanding GPCR biology?

Research on srb-18 has several promising applications that could advance our understanding of GPCR biology:

  • Model System for Studying GPCR Evolution:
    C. elegans srb-18 represents an evolutionary ancient GPCR, providing insights into the structural and functional conservation of these receptors across species. Comparing srb-18 with mammalian GPCRs can reveal fundamental aspects of receptor signaling that have been conserved through evolution.

  • Understanding GPCR Dimerization:
    Studies have shown that homodimerization in rhodopsin-like GPCRs can be associated with negative cooperativity . Research on srb-18 dimerization could reveal whether this property extends to this receptor family and how dimerization affects signaling dynamics.

  • Membrane Protein Structural Biology:
    As a serpentine receptor with seven transmembrane domains, srb-18 provides an opportunity to study the structural determinants of membrane protein folding, stability, and function. This knowledge can inform broader understanding of membrane protein biology.

  • Signal Transduction Mechanisms:
    By studying the signaling pathways downstream of srb-18, researchers can gain insights into the complex signaling networks controlled by GPCRs. This has potential parallels to other systems, such as the GPR180-mediated pathways in Plasmodium, which involves cGMP-PKG-calcium signaling .

How might genetic variation in srb-18 affect its function and signaling properties?

Genetic variation in srb-18 could significantly impact its function and signaling properties, with implications for understanding receptor biology:

Potential Effects of Variation:

  • Extracellular Loop Variations:
    Research on similar proteins has shown that many variations are located on extracellular loops, which tend to interact with the host environment . These variations could affect:

    • Ligand recognition and binding affinity

    • Receptor activation thresholds

    • Interaction with extracellular modulators

  • Transmembrane Domain Variations:
    Mutations in the transmembrane domains could influence:

    • Receptor stability in the membrane

    • Conformational changes associated with activation

    • Dimerization properties and cooperativity

    • G-protein coupling specificity

  • Intracellular Region Variations:
    Changes in the intracellular domains might affect:

    • G-protein recognition and binding

    • Interaction with arrestins and other regulatory proteins

    • Receptor phosphorylation and desensitization kinetics

    • Internalization and trafficking

Experimental Approaches to Study Variation Effects:

To systematically analyze the impact of genetic variations in srb-18, researchers could employ:

  • Site-directed mutagenesis to introduce specific variations

  • Functional assays to assess changes in signaling properties

  • Structural studies to determine conformational changes

  • Molecular dynamics simulations to predict the effect of mutations on receptor dynamics

These approaches would provide valuable insights into structure-function relationships in GPCRs and could potentially be applied to understand disease-associated mutations in human GPCRs.

What novel experimental technologies might advance srb-18 research in the coming years?

Several emerging technologies hold promise for advancing srb-18 research:

  • Cryo-Electron Microscopy (Cryo-EM):
    Recent advances in cryo-EM have revolutionized membrane protein structural biology, enabling determination of structures at near-atomic resolution without the need for crystallization. This could allow visualization of srb-18 in different conformational states and in complex with signaling partners.

  • Single-Molecule FRET (smFRET):
    This technique allows observation of conformational dynamics of individual receptor molecules in real-time. Application to srb-18 could reveal the dynamic aspects of receptor activation, providing insights beyond static structural information.

  • Nanobody-Based Tools:
    Developing nanobodies (single-domain antibody fragments) against specific conformations of srb-18 could provide tools for:

    • Stabilizing specific receptor states for structural studies

    • Probing receptor activation in cellular contexts

    • Modulating receptor function with high specificity

  • Optogenetic and Chemogenetic Approaches:
    Engineering light- or ligand-responsive elements into srb-18 would enable precise temporal control of receptor activation in vivo, facilitating studies of downstream signaling dynamics and cellular responses.

  • CRISPR-Based Genomic Engineering:
    Advanced CRISPR technologies enable precise genomic modifications, allowing:

    • Generation of tagged receptors at endogenous expression levels

    • Creation of conditional knockout models

    • Introduction of specific mutations to study structure-function relationships

  • Artificial Intelligence for Data Integration:
    Machine learning approaches can help integrate diverse datasets from structural, functional, and genomic studies to develop predictive models of srb-18 function and identify novel patterns in complex data.

These technologies, especially when used in combination, have the potential to dramatically accelerate our understanding of srb-18 biology and GPCR function more broadly.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.