Recombinant Serpentine receptor class beta-1 (srb-1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate your specific requirements. Please indicate your preferred format in the order notes and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. Should you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your own formulations.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
While the tag type is determined during production, we are open to developing proteins with your specified tag if you have a particular requirement. Please communicate your desired tag type to us.
Synonyms
srb-1; C27D6.10; Serpentine receptor class beta-1; Protein srb-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-341
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
srb-1
Target Protein Sequence
MNIENKCDLAFEVTYHPLYRAAQFWTFIFSTLAVPALFIFLLKQIFPLPFHGNIKFMLIS YFLSAFLFAVVLALTFGYHILVPLFITSKCDLIIQPYLFKVGQLSLTLFITLQMIMPFGF SIERIIALRMAKSYENVRTVLGPLLIFVLIGIDLILLFTVFRDESFNDSFISFILIPATT AQTFNSYCWILLYAELGNLLCNCIILLVHSKFKTKFLHQQRSLSVRYELEEISQTSKFTL IVSFTHILFIGWYLGVTIFIRTVGETFFGSYINYTVARGVYISVPTYNLTIVFVGIKALS FMNLKRQNNVQSKVQIKSTGSEGARNYENAIASYWNSVSKA
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_C27D6.10

STRING: 6239.C27D6.10

UniGene: Cel.36897

Protein Families
Nematode receptor-like protein srb family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of SRB-1 and how does it compare to other serpentine receptors?

SRB-1 is a member of the serpentine receptor class B family, which are G-protein-coupled receptors (GPCRs) characterized by seven transmembrane domains. Like other class B scavenger receptors (including SR-B1 in mammals), the protein contains a large extracellular domain, two transmembrane domains, and short N- and C-terminal cytoplasmic tails .

The typical structure includes:

  • Seven transmembrane regions spanning the cell membrane

  • Cytoplasmic domains involved in G-protein coupling

  • Extracellular domains involved in ligand binding

When comparing SRB-1 to other serpentine receptors like SRB-5 or SRB-6, multiple sequence alignment reveals conserved regions that are critical for function, particularly in the transmembrane domains. Visualization tools like CLUSTAL Omega can be used to identify these conserved regions across SRB proteins .

How are SRB-1 receptors typically expressed and purified for research purposes?

Recombinant SRB-1 is commonly expressed using bacterial expression systems similar to those used for SRB-5 . The general methodology involves:

  • Cloning the full-length SRB-1 gene into an expression vector with an appropriate tag (commonly His-tag)

  • Transforming the construct into E. coli expression strains

  • Inducing protein expression under optimized conditions

  • Lysing cells and purifying the protein using affinity chromatography

  • Further purification steps may include size exclusion chromatography or ion exchange chromatography

  • Confirming purity using SDS-PAGE (>90% purity is typically desired)

The purified protein is usually stored in a buffer containing stabilizers like trehalose (6%) at -20°C/-80°C, with aliquoting recommended to avoid freeze-thaw cycles .

What experimental designs are most suitable for investigating SRB-1 signaling pathways?

When investigating SRB-1 signaling pathways, several experimental designs have proven effective:

Single-Case Experimental Designs (SCEDs): These are particularly useful for studying the effects of SRB-1 in individual organisms or cells . Key design options include:

  • Reversal Designs (A-B-A): Where:

    • A: Baseline or no-treatment phase

    • B: SRB-1 activation/inhibition phase

    • A: Return to baseline

  • Multiple Baseline Designs: Useful when studying SRB-1 across different tissues or cell types simultaneously.

  • Combined Designs: For more complex investigations, combining reversal and multiple baseline approaches.

For robust experimental control, randomization of intervention order is recommended, with a minimum of three replications to ensure confidence in the relationship between treatment and outcome .

How can I design experiments to study SRB-1 interaction with G proteins?

Based on studies of similar receptors like β1-adrenergic receptor and its G protein interactions, the following methodologies are recommended :

  • Proximity Ligation Assay (PLA): To directly validate SRB-1 binding to specific G proteins

  • Co-immunoprecipitation (CO-IP): To confirm protein-protein interactions

  • Concentration-dependent and Time-dependent Binding Assays: To establish binding kinetics

  • Use of PTX (Pertussis Toxin): To block specific G protein interactions as a control

A systematic approach should include:

Experimental StepMethodologyExpected Outcome
Expression validationWestern blotting/immunofluorescenceConfirmation of SRB-1 expression
Ligand screeningBinding assays with potential ligandsIdentification of SRB-1 activators
G-protein couplingPLA, CO-IPDetermination of G-protein preference
Downstream signalingcAMP/cGMP assays, Ca²⁺ imagingCharacterization of signaling pathways
Functional outcomesCell-specific functional assaysBiological significance of activation

How do I approach homology modeling of SRB-1 in the absence of a crystal structure?

In the absence of a crystal structure for SRB-1, homology modeling provides valuable structural insights. Based on approaches used for similar receptors , the following methodology is recommended:

  • Template Selection: Identify suitable templates from related proteins with resolved structures. For class B scavenger receptors, structures of CD36 and LIMP-2 serve as excellent templates due to high sequence similarity (~66%) .

  • Modeling Approach: Use transform-restrained Rosetta (trRosetta) or similar approaches that incorporate deep learning with known structures of homologs .

  • Model Validation:

    • Compare against previously published mutagenesis studies

    • Validate transmembrane predictions with tools that identify hydrophobic regions

    • Use molecular dynamics simulations to test model stability

  • Structure-Function Correlations: Map known functional domains and mutations onto the model to generate structurally informed hypotheses about SRB-1's function.

This approach has been successfully applied to SR-B1, revealing insights into how structural elements drive function in cholesterol transport .

What methods can I use to investigate the role of SRB-1 in chemosensation in C. elegans?

Based on studies of SRB chemosensory receptors in C. elegans , the following methodological approach is recommended:

  • Genetic Approaches:

    • Generate SRB-1 knockout/knockdown using CRISPR-Cas9 or RNAi

    • Create transgenic lines expressing fluorescently tagged SRB-1 to track localization

    • Employ tissue-specific promoters to restrict expression to specific neurons

  • Behavioral Assays:

    • Chemotaxis assays to test response to potential ligands

    • Avoidance assays to test repellent sensing

    • Male mating efficiency tests (if studying reproductive behaviors)

  • Cellular and Molecular Assays:

    • Ca²⁺ imaging in sensory neurons expressing SRB-1

    • Electrophysiological recordings from sensory neurons

    • Gene expression analysis following receptor activation

  • Environmental Manipulations:

    • Test receptor function under different oxygen conditions (as oxygen sensing interacts with chemosensation)

    • Evaluate impacts of different developmental stages or prior environmental exposures

The critical time period for some SRB signaling (like SRB-13) appears to be prior to specific developmental transitions, suggesting timing considerations are important in experimental design .

What statistical approaches are most appropriate for analyzing SRB-1 receptor studies?

Statistical analysis for SRB-1 studies requires careful consideration of experimental design and data characteristics :

  • For Single-Case Experimental Designs:

    • Visual inspection of data is primary, looking for stability within phases and clear changes between phases

    • Minimum of 5 data points per phase is recommended

    • Effect size calculations to quantify magnitude of changes

    • Randomization tests for establishing statistical significance

  • For Group Designs:

    • Parametric tests (t-tests, ANOVA) when assumptions are met

    • Non-parametric alternatives when data violates assumptions

    • Mixed-effects models for repeated measures designs

    • Control for multiple comparisons using appropriate corrections

  • For Dose-Response Studies:

    • Curve fitting to appropriate models (e.g., logistic models)

    • IC50/EC50 calculations using specialized software

    • Statistical comparison of curve parameters between conditions

When analyzing variability, remember that control over variability is possible through standardized procedures, uniform instructions, and control of extraneous experimental stimuli, which increases sensitivity to treatment effects .

What are common problems in recombinant SRB-1 protein production and how can they be addressed?

Based on experiences with similar recombinant proteins , these are common challenges and solutions:

ProblemPossible CausesSolutions
Low expression yieldProtein toxicity, inefficient codon usageOptimize codon usage, use specialized strains, lower induction temperature
Inclusion body formationImproper folding, high expression rateExpress at lower temperatures (16-20°C), use solubility-enhancing tags, optimize buffer conditions
Protein degradationProteolysis during purificationInclude protease inhibitors, use protease-deficient strains, optimize purification speed
Loss of activityImproper folding, loss of cofactorsInclude appropriate cofactors in buffer, optimize refolding protocols if needed
Aggregation after purificationSuboptimal buffer conditionsOptimize buffer components, include glycerol (5-50%), avoid freeze-thaw cycles

Specific recommendations for SRB-1:

  • Store in Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • Reconstitute to 0.1-1.0 mg/mL concentration

  • Add 5-50% glycerol for long-term storage

  • Store working aliquots at 4°C for up to one week

How does SRB-1 function compare with mammalian SR-B1, and what are the implications for translational research?

While SRB-1 in C. elegans and SR-B1 in mammals are not direct orthologs, they share structural similarities as class B scavenger receptors :

Structural Comparisons:

  • Both contain characteristic class B scavenger receptor architecture

  • Both have multiple transmembrane domains

  • Both function in sensory/signaling capacities

Functional Differences:

  • Mammalian SR-B1 primarily functions in HDL-cholesterol transport

  • SRB-1 in C. elegans functions primarily in chemosensation

  • SR-B1 plays critical roles in cardiovascular disease prevention, while SRB-1 appears more focused on environmental sensing

Translational Implications:

  • Understanding the structural basis of ligand binding in SRB-1 could inform drug design targeting mammalian SR-B1

  • Conserved signaling mechanisms might reveal fundamental principles of GPCR function

  • C. elegans SRB-1 studies provide a simplified model system for studying receptor trafficking, localization, and activation

What advanced imaging approaches can be used to study SRB-1 localization and trafficking?

Based on imaging studies of similar receptors , these advanced approaches are recommended:

  • Super-Resolution Microscopy:

    • STORM or PALM imaging to visualize receptor clustering below diffraction limit

    • SIM for improved resolution of membrane localization patterns

  • Live-Cell Imaging:

    • FRAP (Fluorescence Recovery After Photobleaching) to measure receptor mobility

    • Single-particle tracking to follow individual receptor molecules

    • FRET-based approaches to detect protein-protein interactions

  • Correlative Approaches:

    • Combine fluorescence microscopy with electron microscopy for ultrastructural context

    • Use optogenetic tools to manipulate receptor function while imaging

  • Specialized Probes:

    • pH-sensitive fluorophores to track endocytosis and recycling

    • Binding-sensitive probes that change fluorescence upon ligand binding

    • Biosensors for downstream signaling events (cAMP, Ca²⁺)

A successful example from studies of scavenger receptors shows how in vitro imaging of receptor clustering upon engagement of multivalent ligands can reveal signal transduction mechanisms and receptor-ligand complex endocytosis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.