Recombinant Serpentine receptor class beta-3 (srb-3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance; additional fees apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
srb-3; C27D6.8; Serpentine receptor class beta-3; Protein srb-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-341
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
srb-3
Target Protein Sequence
MLETNDSVCELAYQLAYHPVYRSSQFWSMLVSSLSIPALIYFITRKIFFLHFHGNLKCLL IVYFICNLLFSMALCFAFFYQFLIPFFVTSKCQLLINTTLFKWGQICSFLLLTSSMLLPI GFSIERFVALGNAQKYESSRTFLGPVIIFIIIAVDFSIIFSVYKNEPFTEGFYSFILVPS TTASQINMYFFVLLFVKIFNLLLNCILLRIHKKIRIKYYSLSVRYEMEEILQSSKFTFII RFTHLLFFGFYVVVILFVRIMGESFFNGTLNYSVARGVFCTVPTYNLIIVIIGIKSLRHL NLQRLNKVQSTVQIKSTGKEGSKNYEDIITNYWDSVSSRTP
Uniprot No.

Target Background

Function
G-protein coupled receptor.
Database Links

KEGG: cel:CELE_C27D6.8

UniGene: Cel.28755

Protein Families
Nematode receptor-like protein srb family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Perikaryon. Cell projection, dendrite.
Tissue Specificity
Expressed throughout the head.

Q&A

What is the Serpentine Receptor Class Beta-3 and what organism is it primarily studied in?

Serpentine Receptor Class Beta-3 (srb-3) is a G protein-coupled receptor found in Caenorhabditis elegans. The full-length protein consists of 341 amino acids and is characterized by its serpentine (multi-pass transmembrane) structure typical of G protein-coupled receptors. The recombinant version is commonly expressed with a His-tag to facilitate purification and experimental applications .

What expression systems are most effective for producing recombinant srb-3 protein?

E. coli has been established as an effective expression system for recombinant srb-3 protein. The protein can be successfully expressed with an N-terminal His-tag, facilitating subsequent purification steps. When designing expression protocols, researchers should consider:

  • Optimal codon usage for E. coli

  • Appropriate induction conditions (temperature, IPTG concentration)

  • Expression vector selection based on desired fusion tags

  • Cell lysis conditions that preserve protein functionality

While E. coli is commonly used, researchers investigating protein folding or post-translational modifications may consider eukaryotic expression systems for comparative studies of receptor functionality .

What purification strategies yield the highest purity srb-3 protein preparations?

High-purity srb-3 protein (>90% as determined by SDS-PAGE) can be achieved through a strategic purification workflow:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) utilizing the N-terminal His-tag

  • Intermediate purification: Ion exchange chromatography based on the protein's isoelectric point

  • Polishing step: Size exclusion chromatography to remove aggregates and achieve final purity

The purified protein is typically obtained as a lyophilized powder, which provides stability for long-term storage. For specialized applications requiring higher purity, additional chromatographic steps may be considered, though these should be balanced against potential yield losses .

What are the optimal storage conditions for maintaining srb-3 protein stability?

Optimal storage conditions for recombinant srb-3 protein are critical for maintaining biological activity:

Storage FormRecommended ConditionsDurationSpecial Considerations
Lyophilized powder-20°C to -80°CLong-termStore in airtight containers with desiccant
Reconstituted aliquots4°CUp to one weekAvoid repeated freeze-thaw cycles
Working solutions4°CHours to daysAdd glycerol (5-50%) for better stability

The protein is typically provided in a Tris/PBS-based buffer with 6% trehalose at pH 8.0, which enhances stability during freeze-thaw cycles. After reconstitution, it's strongly recommended to add glycerol (final concentration of 5-50%) and create multiple small-volume aliquots to avoid degradation from repeated freeze-thaw cycles .

How should researchers approach reconstitution of lyophilized srb-3 protein for experimental use?

For optimal reconstitution of lyophilized srb-3 protein:

  • Briefly centrifuge the vial before opening to collect all material at the bottom

  • Reconstitute in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • Gently mix until completely dissolved (avoid vortexing which may cause protein denaturation)

  • Add glycerol to a final concentration of 5-50% (commonly 50%)

  • Prepare small working aliquots to avoid repeated freeze-thaw cycles

  • Store reconstituted aliquots at -20°C/-80°C for long-term storage or at 4°C for up to one week

This methodological approach ensures maximum protein recovery while maintaining structural integrity and biological activity. For specialized applications requiring different buffer conditions, researchers should implement step-wise dialysis to prevent protein precipitation or denaturation .

How can researchers effectively design binding assays using recombinant srb-3 protein?

When designing binding assays with recombinant srb-3 protein, researchers should consider:

  • Assay format selection: Surface plasmon resonance (SPR), microscale thermophoresis (MST), or ELISA-based approaches leveraging the His-tag for immobilization

  • Buffer optimization: Testing various buffer compositions, including:

    • pH range (typically 7.0-8.0)

    • Salt concentration (150-300 mM NaCl)

    • Addition of detergents for membrane protein stability

  • Control design: Include positive controls (known ligands if available) and negative controls (non-specific proteins)

  • Concentration range: Establish appropriate protein concentrations based on estimated Kd values

  • Data analysis: Apply appropriate binding models (one-site, two-site, cooperative binding)

For membrane proteins like srb-3, inclusion of mild detergents or lipid nanodiscs may better preserve the native conformation and improve experimental outcomes.

What are the methodological considerations for investigating protein-protein interactions involving srb-3?

Investigating protein-protein interactions with srb-3 requires careful methodological planning:

  • Co-immunoprecipitation approaches:

    • Leverage the His-tag for pull-down experiments

    • Consider crosslinking strategies for transient interactions

    • Include appropriate washing steps to reduce non-specific binding

  • Biophysical methods:

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Analytical ultracentrifugation for complex formation analysis

    • Fluorescence-based techniques for real-time interaction studies

  • Structural biology approaches:

    • X-ray crystallography of complexes (challenging for membrane proteins)

    • Cryo-EM for larger complexes

    • NMR for mapping interaction interfaces

  • Cellular validation:

    • Proximity ligation assays

    • FRET/BRET approaches

    • Bimolecular fluorescence complementation

When designing these experiments, maintaining the native conformation of srb-3 is critical, often requiring specialized conditions that mimic the membrane environment.

How can site-directed mutagenesis of srb-3 be used to investigate structure-function relationships?

Site-directed mutagenesis provides powerful insights into structure-function relationships of srb-3:

  • Target selection strategy:

    • Conserved residues across serpentine receptor family

    • Putative ligand-binding pocket residues

    • Transmembrane domain boundaries

    • Intracellular G-protein coupling regions

  • Mutation design principles:

    • Conservative substitutions to test hydrogen bonding

    • Charge reversals to test electrostatic interactions

    • Alanine scanning to identify essential residues

    • Cysteine mutagenesis for accessibility studies

  • Functional characterization:

    • Ligand binding assays with mutants

    • G-protein activation measurements

    • Subcellular localization studies

    • Conformational stability analysis

  • Data interpretation framework:

    • Correlation with homology models

    • Comparison with related receptors

    • Integration with available structural data

    • Computational modeling validation

This systematic approach allows researchers to map functional domains, identify critical residues for ligand interaction, and understand signaling mechanisms.

What approaches are most effective for investigating signaling pathways downstream of srb-3 activation?

Investigating signaling pathways downstream of srb-3 activation requires integration of multiple methodological approaches:

  • G-protein coupling specificity:

    • GTPγS binding assays

    • BRET-based G-protein activation sensors

    • Reconstitution with purified G-proteins

    • Chemical crosslinking of receptor-G-protein complexes

  • Second messenger quantification:

    • cAMP/cGMP measurements

    • Calcium mobilization assays

    • Phospholipase activation

    • ERK/MAPK phosphorylation cascades

  • Transcriptional responses:

    • Reporter gene assays

    • RNA-seq for global transcriptional changes

    • ChIP-seq for identifying regulated promoters

    • Proteomics for translation effects

  • Systems biology integration:

    • Pathway reconstruction

    • Network analysis

    • Temporal signaling dynamics

    • Feedback regulation mechanisms

These methodologies should be applied in both heterologous expression systems and, ideally, in C. elegans models to validate physiological relevance of findings.

What are the common challenges in working with recombinant srb-3 and how can they be addressed?

Common challenges and their solutions when working with recombinant srb-3 include:

ChallengePotential CausesOptimization Strategies
Low expression yieldToxicity to expression host, protein instabilityOptimize induction conditions, use specialized E. coli strains, consider fusion partners
Poor solubilityMembrane protein nature, improper foldingInclude mild detergents, use solubility tags, optimize buffer conditions
Protein aggregationImproper reconstitution, concentration too highReconstitute slowly, maintain lower concentrations, add stabilizing agents
Limited stabilitySusceptibility to proteolysis, oxidationAdd protease inhibitors, include reducing agents, optimize pH
Non-specific bindingExposed hydrophobic regionsAdjust detergent type/concentration, increase salt concentration, add blocking agents

When confronting these challenges, an iterative optimization approach focusing on sequential improvement of expression, purification, and storage conditions will yield the best results.

How can researchers validate that recombinant srb-3 maintains its native conformation and activity?

Validating the native conformation and activity of recombinant srb-3 requires multiple complementary approaches:

  • Structural validation:

    • Circular dichroism spectroscopy to confirm secondary structure

    • Fluorescence spectroscopy to assess tertiary structure

    • Limited proteolysis patterns compared to native protein

    • Thermal stability analyses (differential scanning fluorimetry)

  • Functional validation:

    • Ligand binding assays (if ligands are known)

    • Conformational antibody recognition

    • G-protein coupling efficiency

    • Reconstitution into artificial membranes

  • Comparative approaches:

    • Activity comparison with protein expressed in eukaryotic systems

    • Comparison with other serpentine receptors of known structure/function

    • In silico structural prediction validation

    • Conservation analysis of critical functional residues

Researchers should employ multiple orthogonal methods rather than relying on a single validation approach to ensure comprehensive assessment of protein integrity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.