Recombinant Serpentine receptor class beta-6 (srb-6)

Shipped with Ice Packs
In Stock

Description

Role in Chemosensation and Sensory Signaling

srb-6 is predicted to mediate sensory signaling, akin to other SRB receptors in C. elegans. For example:

  • SRB-13 (a related receptor) regulates sperm motility, mitochondrial function, and gene expression via Gα pathways in amphid sensory neurons .

  • SRB-16 shares expression patterns with SRB-13 and influences sperm navigation under ambient oxygen conditions .

Though srb-6’s specific ligands or signaling partners remain uncharacterized, its structural homology suggests potential roles in detecting environmental cues or modulating cellular responses.

Mitochondrial and Metabolic Regulation

Studies on SRB-13 highlight its impact on mitochondrial gene expression and oxidative metabolism . While not directly linked to srb-6, this suggests that serpentine receptors may broadly influence energy pathways. Recombinant srb-6 could serve as a tool to explore analogous mechanisms.

Applications in Research

Recombinant srb-6 is utilized in biochemical and functional studies, including:

ApplicationDetailsSource
ELISA DevelopmentUsed as an antigen for antibody validation or ligand-binding assays
Structural StudiesX-ray crystallography or cryo-EM to resolve receptor-ligand interactions
Chemosensory Pathway MappingInvestigating receptor signaling networks in C. elegans sensory neurons

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
srb-6; R05H5.6; Serpentine receptor class beta-6; Protein srb-6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-337
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
srb-6
Target Protein Sequence
MNDCDEVNNISYDPLYRYSQFYTLLTSIFSVFPLLYLIIFKLRVCTFNDNIKFLYIVYFT QILISVLNNCVVFAHHVVIPFLAVSKCDLLVNPVKNRIFQNIGVFGISCPMLTILGITAE RLLALIFARCYENVKLHIGVFIGVFAMLCDMALVYFFFLDEKFDQPSISYFMVPDTSGYK MNWLCYSLLAINSVNLVFNYFLVKINTILKEKWRNSLSTRYQMEENIITTKFSTFISFIH VFFFSLYLIFTLIIRLLGPGFLKTQADLMSVRGVYITIPTYNLIIGIASCVILRHLQRQK VAKVYAEVTLKYSGIDGAQIHQEAILNVWKTKSSGRK
Uniprot No.

Target Background

Function
Mediates the recognition and avoidance of *Streptomyces* species by detecting dodecanoic acid, a bacterial secretion. It also mediates avoidance of decanoic acid, although this is not a *Streptomyces* secretion; this response may represent a crucial environmental avoidance mechanism.
Database Links

KEGG: cel:CELE_R05H5.6

STRING: 6239.R05H5.6

UniGene: Cel.14551

Protein Families
Nematode receptor-like protein srb family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the ADL, ADF and ASH chemosensory neurons in the head and in the PHA and PHB chemosensory neurons in the tail. Low expression also observed in the egg-laying structures in the mid-body region.

Q&A

What is Serpentine Receptor Class Beta-6 (SRB-6) and what organism expresses it?

SRB-6 is a G-protein-coupled receptor (GPCR) found in Caenorhabditis elegans that plays a crucial role in chemosensation and avoidance behavior. It belongs to the serpentine receptor class beta family and is essential for detecting and mediating avoidance responses to potentially harmful substances, particularly bacterial metabolites like dodecanoic acid produced by Streptomyces species .

Where is SRB-6 expressed in C. elegans?

SRB-6 exhibits specific neuronal expression patterns in C. elegans. It is expressed in the phasmid chemosensory neurons PHA and PHB located in the tail region. Additionally, SRB-6 is expressed in a subset of amphid chemosensory neurons in the head region, specifically ASH, ADL, and ADF neurons .

What is the functional significance of SRB-6 in C. elegans?

SRB-6 mediates rapid avoidance responses to potentially harmful substances. Research demonstrates that SRB-6 is essential for C. elegans to detect and avoid Streptomyces bacteria and dodecanoic acid, a fatty acid with nematicidal properties secreted by these bacteria. This behavioral adaptation represents an important survival mechanism for C. elegans to avoid toxin-producing microorganisms in its environment .

How can researchers effectively produce recombinant SRB-6?

While specific methods for SRB-6 expression aren't detailed in the literature, approaches similar to those used for related serpentine receptors (like SRB-5) could be applicable. Based on established techniques for GPCR expression, researchers might consider:

Expression SystemAdvantagesConsiderations
Cell-free ExpressionRapid production, >85% purity achievableMay lack post-translational modifications
E. coliCost-effective, scalableMay require optimization for membrane proteins
YeastEukaryotic processing capabilitiesGood for functional studies
BaculovirusHigh yield, proper foldingPreferred for structural analysis
Mammalian CellsNative-like environmentIdeal for complex functional assays

Purification should target >85% purity as determined by SDS-PAGE, similar to standards for other serpentine receptors .

What methodologies can effectively assess SRB-6 function?

To evaluate SRB-6 function, researchers have employed several complementary approaches:

  • Genetic approaches: Utilizing SRB-6 mutants to assess loss-of-function phenotypes in avoidance behaviors .

  • Rescue experiments: Expressing SRB-6 cDNA under the direction of cell-specific promoters (e.g., ocr-2 promoter for PHA and PHB neurons) to confirm the cellular basis of SRB-6 function .

  • Behavioral assays: Measuring avoidance responses to Streptomyces species and purified dodecanoic acid in both head and tail regions of C. elegans .

  • Neuronal imaging: While not explicitly mentioned for SRB-6, calcium imaging techniques could be adapted to visualize neuronal activity in SRB-6-expressing neurons in response to stimuli.

What controls are essential in SRB-6 experimental design?

Based on published research methodologies, critical controls include:

  • Wild-type C. elegans: To establish baseline avoidance responses .

  • SRB-6 null mutants: To confirm specificity of observed phenotypes .

  • Cell-specific rescue lines: To validate the site of SRB-6 action (e.g., PHA and PHB neurons) .

  • Vehicle controls: For chemical stimuli applications.

  • Non-Streptomyces bacteria: As negative controls for bacterial avoidance assays.

  • Concentration gradients: Of dodecanoic acid to establish dose-dependency of responses.

How does SRB-6 specifically detect dodecanoic acid?

While the precise molecular mechanism remains under investigation, structural homology modeling suggests that like other GPCRs, SRB-6 likely contains a specialized binding pocket within its transmembrane domains. GPCRs typically undergo conformational changes upon ligand binding that activate associated G-proteins . For SRB-6, this binding specificity for dodecanoic acid represents an evolutionary adaptation for detecting nematicidal compounds produced by potentially harmful bacteria .

What are the key structural features of SRB-6 compared to other GPCRs?

Although specific structural information about SRB-6 is limited in the literature, insights can be drawn from other class A GPCRs. Class A GPCRs typically contain seven transmembrane helices with conserved structural elements. Like other sensory GPCRs, SRB-6 likely contains specialized regions for ligand recognition and G-protein coupling. The binding specificity for dodecanoic acid suggests unique structural features in the ligand-binding domain .

How do SRB-6-expressing neurons integrate into the broader neural circuitry?

SRB-6 is expressed in specific sensory neurons (PHA, PHB, ASH, ADL, and ADF) that detect environmental chemicals. These neurons form part of a neural circuit that processes sensory information and triggers appropriate behavioral responses. The expression of SRB-6 in both head (amphid) and tail (phasmid) sensory neurons suggests redundant detection mechanisms to ensure robust avoidance behaviors. The downstream signaling components and interneurons that process SRB-6-mediated signals represent important areas for future research .

How should researchers analyze SRB-6-mediated behavioral responses?

Analysis of SRB-6-mediated behaviors requires quantitative assessment methods similar to those used in behavioral neuroscience:

  • Temporal analysis: Measuring the latency to initiate avoidance responses following exposure to stimuli.

  • Population analysis: Calculating the percentage of animals exhibiting avoidance behaviors.

  • Quantitative scoring: Using defined criteria to score the magnitude of avoidance responses.

  • Statistical comparison: Between wild-type, mutant, and rescue lines using appropriate statistical tests (ANOVA, t-tests).

For cell-based assays with recombinant SRB-6, approaches similar to the SRB assay methodology could be adapted for quantifying cellular responses, though this would require significant modification from the cytotoxicity context of the standard SRB assay .

What approaches can resolve contradictory findings in SRB-6 research?

When encountering contradictory data in SRB-6 research, consider:

  • Methodological differences: Variations in experimental conditions, stimulus concentration, or behavioral scoring criteria.

  • Genetic background effects: Potential modifier genes or compensatory mechanisms in different C. elegans strains.

  • Developmental variables: Age-dependent changes in SRB-6 expression or function.

  • Environmental factors: Temperature, cultivation conditions, or bacterial food sources affecting sensory responses.

  • Receptor redundancy: Potential overlap with other chemoreceptors that might compensate for SRB-6 in certain conditions.

Triangulation using multiple experimental approaches can help resolve contradictions.

What are promising applications of recombinant SRB-6 in sensory biology?

Recombinant SRB-6 could serve several innovative research purposes:

  • Structural studies: Elucidating the binding mechanism of dodecanoic acid and related compounds.

  • High-throughput screening: Identifying novel ligands or modulators of SRB-6 function.

  • Biosensor development: Creating detection systems for fatty acids or bacterial metabolites.

  • Comparative biology: Examining evolutionary conservation of chemosensory mechanisms across species.

  • Drug discovery platforms: Potentially identifying compounds that modulate chemosensation.

How might understanding SRB-6 inform broader neurobiological principles?

Research on SRB-6 extends beyond C. elegans biology to inform fundamental concepts in neuroscience:

  • Sensory coding: How specific receptors encode chemical information into neural signals.

  • Neural circuit function: How sensory information is processed to generate appropriate behaviors.

  • Evolutionary adaptations: How organisms evolve specific detection mechanisms for environmental threats.

  • GPCR signaling mechanisms: Potentially revealing conserved or divergent signaling pathways across species.

  • Neuromodulation: How chemical detection systems are regulated by internal state or environmental context.

What technological advances would significantly enhance SRB-6 research?

Several emerging technologies could transform SRB-6 research:

  • Cryo-EM for membrane proteins: Enabling structural determination of SRB-6 in complex with ligands.

  • Advanced optogenetics: For precise temporal control of SRB-6-expressing neurons.

  • CRISPR-based approaches: For generating precise modifications to SRB-6 coding or regulatory regions.

  • Microfluidic systems: For high-throughput analysis of chemosensory behaviors.

  • In silico modeling: Computational approaches for predicting ligand-receptor interactions and receptor activation mechanisms.

What phenotypes are associated with SRB-6 mutations?

SRB-6 mutants display specific behavioral defects:

PhenotypeDescriptionExperimental Context
Tail avoidance defectImpaired ability to detect and avoid Streptomyces and dodecanoic acid at the tailBehavioral assays using presumptive null mutants
Head avoidance defectImpaired ability to detect and avoid Streptomyces and dodecanoic acid at the headBehavioral assays using presumptive null mutants
Rescue capabilityExpression of SRB-6 cDNA under ocr-2 promoter significantly restores avoidance responsesGene rescue experiments in PHA and PHB neurons

How can researchers systematically analyze structure-function relationships in SRB-6?

To investigate structure-function relationships in SRB-6, researchers might employ:

  • Site-directed mutagenesis: Targeting predicted ligand-binding residues based on homology modeling with other GPCRs.

  • Domain swapping: Exchanging domains between SRB-6 and related receptors to identify regions critical for ligand specificity.

  • Chimeric receptors: Creating fusion proteins between SRB-6 and other GPCRs to assess functional domains.

  • Point mutation analysis: Based on evolutionary conservation or predicted structural features, similar to approaches used with other GPCRs like TSHR .

  • Truncation analysis: To identify minimal regions required for function.

These approaches would advance our understanding of how SRB-6 structure relates to its specialized function in chemosensation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.