Recombinant Serpentine receptor class delta-19 (srd-19)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
srd-19; F53F1.11; Serpentine receptor class delta-19; Protein srd-19
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
srd-19
Target Protein Sequence
MIIFFEIWHWSWALLGCYLNLLLTYLAIFRSPKAIKSYATLIINFAATDFVECALDLFIQ TRLVAVPGEAKLVYIFNGPCKYTGSLSCKVGLSFLLHCLTHSVWSLLISFGYRFYILHNP ALSRLTLLKITIMFYIPSLVQALTYWTLFVPREKILPLAKQWFPYYDLETETGVLTGVID LTNFVAVYAVAHICLPFFPVYITIFVLRQKIMKYLGGQSQMMSQDTKAAHTQLLRALTTQ AIIPMFLGIAVLLYFSSQSGLLKSPILEYSIFSVAILMPALSPITYLYFVRPYRQKVKRI IRHPFKLLSRPHERATSNSGVFYSGDHPTHFSKPVIAVH
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_F53F1.11

UniGene: Cel.33027

Protein Families
Nematode receptor-like protein srd family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What experimental techniques are most effective for studying SRD-19 localization?

Fluorescence-based imaging techniques provide powerful tools for analyzing serpentine receptor localization. Fixed-cell confocal immunofluorescence imaging using tagged receptors (such as Flag-tagged constructs) allows for visualization of receptor distribution patterns. This approach can be complemented with co-localization studies using established markers for cellular compartments. For example, Golgi markers like TGN-38 can help quantify the fraction of receptors retained in specific intracellular compartments . When designing these experiments, it's essential to include appropriate controls and quantification methods to accurately assess receptor distribution patterns.

How do I design appropriate mutation studies to investigate SRD-19 functional motifs?

When investigating functional motifs in serpentine receptors, a strategic approach involves:

  • Sequence analysis: Begin by evaluating evolutionary conservation across species to identify highly conserved regions that may contain functional motifs.

  • Deletion mutants: Create specific deletions targeting candidate functional regions.

  • Alanine scanning: Generate point mutations by substituting key residues (particularly charged amino acids like arginine) with alanine.

  • Combination mutations: If individual mutations show partial effects, create combination mutants to test for redundancy.

For example, when studying retention motifs in the delta opioid receptor, researchers identified two conserved RXR motifs (RPR and RER) through cross-species sequence alignment. When individual deletions showed only partial effects, combination mutations of all five arginine residues in these regions demonstrated more complete disruption of the retention phenomenon .

What controls should be included when examining SRD-19 trafficking?

Effective controls for SRD-19 trafficking studies should include:

  • Wild-type receptor expression under identical conditions

  • Baseline vs. stimulated conditions to detect dynamic changes

  • Pharmacological interventions (such as pathway inhibitors)

  • Proper subcellular markers to confirm compartment identity

For example, when studying receptor trafficking, both baseline conditions and specific interventions (like NGF treatment or PI3K inhibition using compounds such as LY294002) should be included to assess dynamic trafficking responses . Quantification should include both the percentage of receptor co-localization with compartment markers and the proportion of cells showing specific localization patterns.

How should protein-protein interaction studies be designed to identify SRD-19 binding partners?

A comprehensive approach to identifying SRD-19 binding partners should employ multiple complementary methods:

  • Co-immunoprecipitation (Co-IP): Using tagged versions of SRD-19 to pull down interacting proteins from cell lysates, followed by immunoblotting for candidate binding partners or mass spectrometry for unbiased discovery .

  • Affinity purification: Creating fusion proteins (such as GST-SRD-19 constructs) to capture binding partners from cell lysates, with appropriate concentration gradients to demonstrate specificity .

  • Domain mapping: Testing truncated versions or specific domains to identify the minimal regions required for protein interactions.

A rigorous approach would include both wild-type and mutant versions of SRD-19, with quantification of binding efficiency. For example, similar studies with delta opioid receptors demonstrated that the C-terminal tail was sufficient for COPI binding, and that arginine residues in RXR motifs were critical for this interaction .

What experimental design is most appropriate for investigating SRD-19 signaling dynamics?

A robust experimental design for investigating SRD-19 signaling should utilize a randomized crossover approach when possible. This design, where subjects or experimental units receive different treatments in a randomized sequence, helps control for time-dependent variables and individual variations in response .

Key elements of such a design include:

  • Randomization of treatment sequence

  • Appropriate washout periods between treatments

  • Clear definition of baseline conditions

  • Multiple measurement timepoints to capture signaling dynamics

  • Inclusion of multiple readouts to capture different aspects of signaling

Design ElementImplementation Strategy
RandomizationTwo-treatment, two-period crossover design
Treatment GroupsGroup 1: Treatment A → Treatment B
Group 2: Treatment B → Treatment A
Analysis ApproachIntention-to-treat analysis with separate site analysis when appropriate
Control for VariationsInclude baseline measurements and demographic factors

How can contradictory findings about SRD-19 function be reconciled through experimental design?

When faced with contradictory findings about receptor function, a systematic approach should:

  • Directly compare experimental conditions from conflicting studies

  • Test for context-dependent effects (cell type, expression level, etc.)

  • Employ multiple complementary techniques to assess the same phenomenon

  • Control for protocol-specific artifacts

For instance, if one study shows predominantly intracellular localization while another shows surface expression, systematic testing of different cell types, expression levels, and detection methods can help identify the source of discrepancy. Analysis should include quantitative assessment across multiple parameters, such as the percentage of cells showing specific patterns and the degree of co-localization with subcellular markers .

What are the best practices for generating and validating recombinant SRD-19 constructs?

Generation of high-quality recombinant SRD-19 requires attention to several key aspects:

  • Expression system selection: Choose systems appropriate for proper folding and post-translational modifications of serpentine receptors.

  • Tag selection and placement: Carefully consider the impact of tags on receptor function. N-terminal tags (such as Flag) are often preferable for serpentine receptors to avoid disrupting C-terminal signaling motifs .

  • Validation approach:

    • Immunoblotting to confirm expression and molecular weight

    • Functional assays to verify signaling capacity

    • Subcellular localization studies to confirm proper trafficking

    • Ligand binding assays to verify structural integrity

  • Control constructs: Include both positive controls (well-characterized receptors) and negative controls (non-functional mutants) in parallel experiments.

How should SRD-19 interactions with regulatory proteins be quantified?

Quantification of SRD-19 interactions with regulatory proteins requires rigorous approaches:

  • For co-immunoprecipitation experiments:

    • Normalize bound protein to total immunoprecipitated receptor

    • Include multiple biological replicates

    • Perform statistical analysis comparing wild-type and mutant constructs

  • For GST pulldown assays:

    • Test multiple concentrations of fusion proteins

    • Include GST-only controls

    • Quantify binding as a function of concentration

This approach has been successfully applied to quantify interactions between delta opioid receptors and Beta-COP (a COPI subunit), demonstrating both specificity and the importance of specific motifs in mediating these interactions .

What statistical approaches are most appropriate for analyzing SRD-19 trafficking data?

When analyzing receptor trafficking data, appropriate statistical approaches include:

  • For co-localization studies:

    • Quantify percentage overlap with compartment markers

    • Calculate Pearson's correlation coefficients for co-localization

    • Compare multiple conditions using ANOVA with appropriate post-hoc tests

  • For cell population studies:

    • Determine the percentage of cells showing specific localization patterns

    • Use chi-square analysis for categorical comparisons

    • Employ mixed-effects models when analyzing multiple parameters

Researchers studying delta opioid receptors effectively used quantification of both the fraction of receptors overlapping with Golgi markers and the number of cells showing intracellular retention under different treatment conditions .

How should contradictions in SRD-19 functional data be addressed methodologically?

When confronting contradictory findings about SRD-19 function, employ these methodological strategies:

  • Systematically test key variables that might explain differences:

    • Expression levels (using titrated transfections)

    • Cell type effects (comparing multiple relevant cell lines)

    • Detection sensitivity (comparing multiple antibodies or visualization techniques)

  • Design experiments with internal controls:

    • Include known control receptors processed in parallel

    • Test multiple timepoints to capture temporal dynamics

    • Employ multiple complementary techniques

  • Analyze data using multiple parameters:

    • Quantify intensity, distribution, and co-localization metrics

    • Apply appropriate statistical tests to determine significance

    • Present data comprehensively rather than selecting supporting results

How can genome editing approaches be applied to study endogenous SRD-19 function?

CRISPR-Cas9 editing provides powerful tools for studying endogenous SRD-19 function:

  • Knockout strategies:

    • Complete gene deletion to assess function

    • Specific domain deletions to assess structural requirements

  • Knockin approaches:

    • Introduction of reporter tags for live imaging

    • Site-specific mutations to test functional motifs identified in overexpression systems

  • Validation strategy:

    • Confirm editing efficiency through sequencing

    • Verify protein absence/modification through immunoblotting

    • Assess functional consequences through appropriate assays

This approach complements overexpression studies by examining the receptor at physiological levels within its native context.

What considerations are important when designing experiments to study SRD-19 in different cellular contexts?

When studying SRD-19 across different cellular contexts, consider:

  • Expression system selection:

    • Primary cells vs. cell lines

    • Tissue-specific contexts that reflect physiological relevance

    • Transfection methods appropriate for each cell type

  • Experimental controls:

    • Include parallel experiments in multiple cell types

    • Control for expression level differences between systems

    • Account for cell-specific differences in trafficking machinery

  • Analysis approach:

    • Compare quantitative metrics across cell types

    • Account for cell-specific variations in baseline measurements

    • Use statistical methods appropriate for cross-system comparisons

These considerations help distinguish between universal SRD-19 properties and context-dependent functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.