Recombinant Serpentine receptor class delta-25 (srd-25)

Shipped with Ice Packs
In Stock

Description

Functional and Research Applications

Primary Uses:

  • Vaccine Development: Investigated as a potential antigen or immunogen due to its cell-surface receptor properties .

  • Neurobiological Studies: C. elegans srd-25 homologs regulate chemosensory and behavioral responses, suggesting utility in neuronal signaling research .

Experimental Findings:

  • Conservation Analysis: Serpentine receptors like srd-25 share structural homology with Plasmodium falciparum PfSR25, including seven transmembrane domains and intracellular loop variations .

  • Expression Systems: Yeast-derived srd-25 shows higher yield (>85% purity) compared to E. coli or mammalian cell systems .

Limitations and Technical Considerations

  • Partial Sequence: The recombinant protein lacks full-length structural domains, limiting functional studies requiring intact receptor conformations .

  • Species Specificity: Antibodies or assays targeting srd-25 may cross-react with homologous receptors in other nematodes .

Future Research Directions

  • Structural Resolution: Cryo-EM or X-ray crystallography could clarify ligand-binding regions.

  • In Vivo Functional Assays: Testing in C. elegans mutants may elucidate its role in chemotaxis or pathogen response.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
srd-25; F07C4.4; Serpentine receptor class delta-25; Protein srd-25
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
srd-25
Target Protein Sequence
MFYQLLHSVLSLVGILSNAFMMYLALKKSPKIMRSYSVVITIKTGTDILASSMSFFVMQR IITDGSSIVVNPTGPCTSFGKSACYAGHMFMLCFLEYDLVWLITSYLFRYTILRGRELCI KKLVRIAFYVFIPSMVHMGVWISIYILTESESVLKGFGIETDDMILSGEIIYWSSITLLT QLFITACLAVVAYTFIRKSLSKFARKMSVIKTNEKNLRNRLVKVATFKLILPSFIFLGIT VFVAMFTRLLDYQYGQYIVSVCFMFSPVCSPYAYIIFVPHYRKFIFGRKENVPKLEQGQC ETPESPRNTPNLPYIYYI
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_F07C4.4

UniGene: Cel.28768

Protein Families
Nematode receptor-like protein srd family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the classification and structural characteristics of Serpentine receptor class delta-25?

Serpentine receptors belong to the G protein-coupled receptor (GPCR) superfamily, which constitutes one of the largest transmembrane signaling molecule families. GPCRs, including serpentine receptors, are characterized by their seven transmembrane (TM) domain structure, which gives them their alternative names of "heptahelical" or "serpentine" receptors. They represent one of the four major classes of receptors in the central nervous system, alongside ionotropic receptors, receptor tyrosine kinases, and nuclear receptors .

The delta class of serpentine receptors represents a specific subfamily within this larger classification system. While the search results don't provide specific structural information for delta-25, serpentine receptors typically feature:

  • Seven membrane-spanning domains

  • An extracellular N-terminus

  • An intracellular C-terminus

  • Three extracellular loops and three intracellular loops

What experimental systems are most appropriate for studying recombinant srd-25?

When studying recombinant serpentine receptors including srd-25, researchers should consider experimental systems that allow for proper protein folding and functional expression. For GPCRs, appropriate experimental systems include:

  • Cell-based expression systems:

    • Mammalian cell lines (HEK293, CHO)

    • Yeast expression systems

    • Insect cell systems (Sf9, High Five)

  • Cell-free expression systems:

    • Wheat germ extracts

    • E. coli lysates with supplemented lipids

The selection of an appropriate experimental system should be guided by your specific research questions. For functional studies, mammalian systems often provide the most physiologically relevant context, while bacterial or yeast systems may offer higher protein yields for structural studies .

What basic experimental design considerations should be addressed when studying srd-25?

When designing experiments to study recombinant srd-25, researchers should follow fundamental experimental design principles to ensure valid, efficient, and economical results. Key considerations include:

  • Clearly defined research problem and questions: Articulate specific hypotheses about srd-25 function or structure before beginning experiments .

  • Appropriate experimental units: Define whether you're using cell lines, tissue samples, or animal models, and ensure consistent handling .

  • Treatment structure: Determine independent variables (e.g., ligand concentrations, mutation sites) and organize them logically .

  • Design structure: Select an appropriate experimental design based on the research question:

    • Completely Randomized Design (CRD): When experimental material is homogeneous

    • Randomized Block Design (RBD): When accounting for known sources of variation

    • Latin Square Design: When controlling for two sources of variation simultaneously

  • Adequate replication: Ensure sufficient replication to detect meaningful effects while balancing resource constraints .

What are the optimal approaches for expressing and purifying functional recombinant srd-25?

Expression and purification of functional recombinant serpentine receptors present significant challenges due to their membrane-integrated nature. While specific protocols for srd-25 are not detailed in the search results, general methodological approaches for serpentine receptor expression include:

  • Vector selection: Use vectors with strong, inducible promoters compatible with your expression system. Consider adding fusion tags (His, FLAG, etc.) to facilitate purification while maintaining protein function.

  • Expression optimization:

    • Temperature modulation (typically lower temperatures slow expression and improve folding)

    • Induction conditions (concentration of inducer, timing)

    • Media supplementation with receptor stabilizers

    • Co-expression with chaperones to improve folding

  • Purification strategy:

    • Detergent selection is critical for membrane protein extraction

    • Two-step purification combining affinity chromatography with size exclusion

    • Consider using nanodiscs or lipid reconstitution for maintaining native-like environment

  • Functional validation:

    • Ligand binding assays

    • G protein coupling assays

    • Conformational antibody recognition

When designing purification protocols, systematically test multiple conditions in parallel using a randomized complete block design, where each "block" represents an independent preparation of starting material, to control for batch-to-batch variation .

How can researchers resolve contradictory data when studying srd-25 signaling pathways?

When faced with contradictory data in srd-25 signaling studies, a systematic approach to reconciliation is essential:

What statistical approaches are most appropriate for analyzing srd-25 functional data?

The statistical analysis of serpentine receptor functional data requires careful consideration of experimental design and data characteristics:

  • Analysis of Variance (ANOVA) approaches based on experimental design:

    • For Completely Randomized Designs: One-way ANOVA with appropriate post-hoc tests

    • For Randomized Complete Block Designs: Two-way ANOVA accounting for treatment and block effects

    • For Latin Square Designs: Three-way ANOVA accounting for row, column, and treatment effects

  • Dose-response analysis:

    • Non-linear regression for fitting dose-response curves

    • Calculation of EC50/IC50 values with confidence intervals

    • Comparison of curve parameters across experimental conditions

  • Assumptions and validations:

    • Test for normality of residuals

    • Assess homogeneity of variance

    • Consider transformations when assumptions are violated

    • Use appropriate corrections for multiple comparisons

The following table summarizes key statistical approaches based on common experimental scenarios in receptor research:

Experimental ScenarioRecommended Statistical ApproachKey Considerations
Ligand binding studiesNon-linear regression (one-site or two-site binding)Test for competitive vs. non-competitive binding
Signal transduction assaysRepeated measures ANOVA or mixed modelsAccount for temporal correlations
Receptor expression analysist-tests or ANOVA with multiple comparison correctionConsider log transformation for expression data
Mutation effects on functionTwo-way ANOVA (mutation × condition)Include wild-type controls in each experiment

How should researchers design experiments to study srd-25 interactions with potential ligands?

Designing robust experiments to identify and characterize ligand interactions with srd-25 requires careful planning:

  • Preliminary screening approaches:

    • In silico docking and virtual screening

    • Medium-throughput binding assays

    • Functional cell-based reporter systems

  • Validation experimental design:

    • Implement a randomized complete block design where each potential ligand is tested across multiple independent receptor preparations to control for batch effects

    • Include positive controls (known ligands for related receptors) and negative controls

    • Blind the analysis phase to prevent unconscious bias

  • Concentration considerations:

    • Design dose-response experiments with concentrations spanning at least 3-4 log units

    • Include a minimum of 6-8 concentration points for accurate curve fitting

    • Test each concentration with at least 3 technical replicates within each biological replicate

  • Comparison across multiple assay types:

    • Direct binding assays (radioligand, fluorescence)

    • Functional assays (G protein activation, β-arrestin recruitment)

    • Conformational change assays (BRET, FRET)

  • Time course considerations:

    • For kinetic studies, implement a split-plot design where the "whole plot" is time point and the "split plot" is treatment

What are the critical factors in designing experiments to assess the impact of mutations on srd-25 function?

When designing mutation studies for serpentine receptors like srd-25, consider these critical experimental design factors:

  • Mutation selection strategy:

    • Alanine scanning of conserved residues

    • Targeted mutations based on structural predictions

    • Conservative vs. non-conservative substitutions

    • Domain-specific mutation panels

  • Experimental design structure:

    • Implement a randomized complete block design where each "block" represents an independent transfection or expression batch

    • Include wild-type controls in every experimental block

    • Consider Latin Square designs when testing multiple mutations across multiple functional assays to control for day and batch effects

  • Functional readouts:

    • Surface expression quantification

    • Ligand binding characteristics

    • G protein coupling efficiency

    • Downstream signaling activation

    • Receptor internalization and trafficking

  • Statistical power considerations:

    • Calculate required sample sizes based on anticipated effect sizes

    • For subtle phenotypes, increase replication

    • Consider power of 0.85 or higher for detecting biologically relevant effects

  • Control constructs:

    • Include known function-altering mutations as positive controls

    • Include mutations in non-conserved regions as negative controls

    • Consider chimeric constructs with related receptors for domain function studies

How can high-throughput methodologies be optimized for srd-25 research?

Optimizing high-throughput methodologies for srd-25 research requires balancing efficiency with experimental rigor:

  • Assay miniaturization and validation:

    • Establish Z-factor scores >0.5 for assay robustness

    • Validate signal-to-background ratios across plate positions

    • Determine minimum required cell numbers or protein amounts

  • Plate design considerations:

    • Implement randomized block designs within plates to control for position effects

    • Include internal controls in standardized positions across all plates

    • Consider edge effects in assay development

  • Automation parameters:

    • Optimize liquid handling parameters for consistent cell dispensing

    • Validate incubation times and temperature uniformity

    • Program appropriate mixing parameters for consistent results

  • Data analysis pipeline:

    • Implement normalization procedures to account for plate-to-plate variation

    • Establish clear criteria for hit identification

    • Develop automated quality control metrics

    • Consider machine learning approaches for complex phenotypic data

  • Statistical approach for hit validation:

    • Follow initial screening with dose-response curves

    • Implement appropriate statistical tests based on experimental design

    • Consider hierarchical analysis approaches for complex datasets

How can researchers effectively investigate srd-25 dimerization and oligomerization?

Investigating dimerization and oligomerization of serpentine receptors requires specialized approaches:

  • Biophysical methods:

    • Resonance energy transfer techniques (FRET, BRET)

    • Single-molecule microscopy

    • Cross-linking followed by SDS-PAGE analysis

    • Fluorescence recovery after photobleaching (FRAP)

  • Experimental design considerations:

    • Implement randomized complete block designs to control for expression level variations

    • Use titration experiments with fixed amounts of one protomer and varying amounts of potential partners

    • Include non-interacting receptor controls

  • Functional validation approaches:

    • Co-immunoprecipitation with differential tagging

    • Bimolecular complementation assays

    • Pharmacological studies with heterodimer-selective compounds

  • Analysis considerations:

    • Distinguish between constitutive and ligand-induced dimerization

    • Account for expression level effects on spontaneous interactions

    • Apply appropriate statistical analysis based on experimental design structure

When analyzing dimerization data, researchers should consider using specialized statistical approaches such as:

  • Bioluminescence/fluorescence resonance energy transfer (BRET/FRET) saturation curve analysis

  • Statistical comparison of apparent BRET50 or FRET50 values

  • Two-way ANOVA to analyze effects of treatments on dimerization across receptor variants

What approaches should be used to study srd-25 trafficking and localization?

Studying trafficking and localization of srd-25 requires integrating multiple methodological approaches:

  • Imaging-based methods:

    • Confocal microscopy with fluorescently-tagged receptors

    • Total internal reflection fluorescence (TIRF) for surface dynamics

    • Super-resolution microscopy for sub-cellular localization

    • Live-cell imaging for trafficking kinetics

  • Biochemical approaches:

    • Surface biotinylation assays

    • Subcellular fractionation

    • Endocytosis and recycling assays with reversible biotinylation

    • Proteolytic digestion of surface proteins

  • Experimental design considerations:

    • Use randomized complete block design with "blocks" representing independent cell preparations

    • Include appropriate controls for non-specific localization

    • Account for expression level effects on trafficking

    • Design appropriate time course experiments

  • Analysis approaches:

    • Quantitative co-localization analysis with organelle markers

    • Kinetic modeling of trafficking rates

    • Statistical comparison of steady-state distributions

    • Two-way ANOVA for comparing effects of mutations or treatments on localization patterns

How can molecular dynamics simulations complement experimental research on srd-25?

Molecular dynamics (MD) simulations provide valuable complementary insights to experimental studies of serpentine receptors:

  • Integration with experimental data:

    • Use experimental structures as starting points when available

    • Validate simulation predictions with mutagenesis experiments

    • Design a systematic experimental plan to test computational hypotheses using randomized block designs

  • Simulation setup considerations:

    • Appropriate membrane composition modeling

    • Sufficient simulation timescales for capturing relevant dynamics

    • Inclusion of relevant binding partners

    • Consideration of different activation states

  • Analysis approaches:

    • Tracking of conformational changes in key domains

    • Identification of stable interaction networks

    • Water and ion pathway analysis

    • Binding free energy calculations

  • Validation approaches:

    • Design experiments to specifically test simulation-derived hypotheses

    • Compare predicted conformational changes with experimental structures

    • Validate predicted binding sites with mutagenesis using systematic experimental designs

  • Statistical considerations:

    • Run multiple simulation replicates to ensure reproducibility

    • Apply appropriate statistical tests to simulation-derived measurements

    • Consider appropriate sampling to avoid bias in conformational analyses

How should researchers interpret contradictory functional data from different expression systems?

When faced with contradictory functional data for serpentine receptors across different expression systems:

  • Systematic comparison approach:

    • Design experiments using Latin Square designs to simultaneously test multiple receptor constructs across multiple expression systems

    • Include appropriate internal controls in each system

    • Standardize data normalization approaches across systems

  • Expression level considerations:

    • Quantify receptor expression in each system

    • Implement experimental designs that control for expression level differences

    • Consider titrating expression levels using inducible promoters

  • Post-translational modification analysis:

    • Evaluate glycosylation patterns across systems

    • Assess phosphorylation states

    • Consider other modifications relevant to function

  • Functional context evaluation:

    • Analyze the endogenous G protein complement in each system

    • Assess the presence of relevant scaffolding proteins

    • Consider membrane composition differences

  • Statistical approach:

    • Implement two-way ANOVA to analyze system × treatment interactions

    • Calculate effect sizes within each system to compare relative responses

    • Consider mixed-effects models when analyzing data across multiple systems and conditions

What quality control measures are essential for ensuring reliable srd-25 research data?

Implementing rigorous quality control measures is essential for reliable serpentine receptor research:

  • Receptor characterization:

    • Verify protein expression by Western blot

    • Confirm proper folding through ligand binding

    • Assess surface expression by flow cytometry or surface biotinylation

    • Verify expected molecular weight and post-translational modifications

  • Experimental controls:

    • Include positive and negative controls in every experiment

    • Implement randomization in experimental design to prevent bias

    • Use biological and technical replicates appropriately

  • Assay validation:

    • Determine assay dynamic range and sensitivity

    • Establish reproducibility metrics between experiments

    • Validate assay with known pharmacological tools

  • Data analysis quality control:

    • Establish clear inclusion/exclusion criteria prior to experimentation

    • Implement blinded analysis when possible

    • Use appropriate statistical tests based on experimental design

    • Check for outliers using standardized methods

  • Reporting standards:

    • Maintain detailed records of experimental conditions

    • Document all data transformations and normalization procedures

    • Report negative results alongside positive findings

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.