Recombinant Serpentine receptor class delta-26 (srd-26)

Shipped with Ice Packs
In Stock

Description

Molecular and Genetic Profile of srd-26

srd-26 is encoded by the srd-26 gene located in C. elegans, a model organism widely used in developmental biology and neurobiology research .

PropertyDetail
Gene Symbolsrd-26
Entrez Gene ID187979
OrganismCaenorhabditis elegans
Protein ProductSerpentine receptor class delta-26
mRNA AccessionNM_074104.2
Protein AccessionNP_506505.1
Gene TypeProtein-coding
ORF Length954 bp
Chromosomal LocationDerived from annotated genomic sequence NC_003283 (Chromosome III)

This receptor belongs to the G protein-coupled receptor (GPCR) superfamily, characterized by seven transmembrane domains .

Recombinant srd-26 Protein Production

Creative Biolabs offers recombinant srd-26 protein (aa 1–317) produced in heterologous systems such as E. coli, yeast, or mammalian cells . This product is designed for research applications, particularly in vaccine development and receptor-ligand interaction studies.

ParameterSpecification
SourceE. coli, Yeast, Baculovirus, or Mammalian Cells
Target SpeciesCaenorhabditis elegans
ApplicationsVaccine research, ligand-binding assays, structural studies
Purity>90% (assay-dependent)
StorageStable at -80°C; avoid freeze-thaw cycles
Molecular Weight~35 kDa (theoretical, unmodified)

The recombinant protein retains the extracellular domain of srd-26, enabling studies on its interaction with ligands or antibodies .

Research Applications and Implications

  1. Vaccine Development: Recombinant srd-26 serves as an antigen candidate for antibody generation, particularly in studying nematode-specific immune responses .

  2. Genetic Studies: The ORF clone enables functional genomics research, including RNA interference (RNAi) and gene knockout experiments in C. elegans .

  3. Structural Biology: As a GPCR, srd-26’s transmembrane domains are of interest for elucidating chemosensory signaling mechanisms in nematodes .

Limitations and Future Directions

Current research is limited by the absence of peer-reviewed studies directly linking srd-26 to specific pathways. Further work could explore its role in:

  • Chemosensation (e.g., response to bacterial metabolites in C. elegans’ soil habitat).

  • Interaction with endogenous ligands or synthetic modulators.

  • Evolutionary conservation across nematode species.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
srd-26; T02B5.4; Serpentine receptor class delta-26; Protein srd-26
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
srd-26
Target Protein Sequence
MLYQLLHTVLSVTGVTLNAFMMYLALTKSPKIMRPCSAIITIKTFTDILTSAMSFFVMQR IVTDGSSILVIPTGPCTRLGPTACYVGHMFMLCFLECNLIWMISSYIFRYYILYVRDPSI KSLVFVALCLSIPSFIHMAAWIRSYDPNEAFVVPDSFGLASSHLILGGHIVYRSTITLIL QLFITSVLVLIAYAWIRNTLLSFAIKMGSDKNDVKNLNARLVKVINFQVFLPTFIFLGFF IFAAMFGRYITVNIAQYLVSIAFMFSPICSPFSYILFVPHYLNVITGNKKPAENRATDMC AVRAFKNPNVSVTMTNA
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_T02B5.4

UniGene: Cel.2532

Protein Families
Nematode receptor-like protein srd family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the serpentine receptor class delta-26 (srd-26) and what physiological functions does it modulate?

Serpentine receptor class delta-26 (srd-26) is a member of the GPCR superfamily, which represents one of the largest and most versatile membrane receptor families. GPCRs can be activated by various ligands ranging from ions to small molecule neurotransmitters and peptide hormones, and they modulate virtually all known physiological processes . Like other GPCRs, srd-26 likely plays a role in signal transduction pathways. The specific physiological functions of srd-26 can be studied through genetic modification techniques such as conditional allele generation, which allows for tissue-specific expression or knockout studies to determine its functional role in different biological contexts.

How do I design an experiment to validate srd-26 expression in specific tissues?

When designing an experiment to validate srd-26 expression, it's essential to consider the experimental unit, treatments, and sampling methodology. Begin by defining your research question clearly and select appropriate experimental units . For tissue-specific expression studies, consider using:

  • Epitope tagging approaches: Similar to the HA-tagging strategy used for delta opioid receptors, you can generate tagged versions of srd-26 to enable detection with commercially available antibodies .

  • Tissue sampling protocol: Ensure proper replication by including multiple biological replicates for each tissue type examined .

  • Controls: Include both positive controls (tissues known to express srd-26) and negative controls (tissues or knockout samples not expected to express the receptor).

  • Quantification method: Use RT-qPCR for mRNA expression or Western blotting with specific antibodies for protein expression.

Remember that the designing of the experiment and the analysis of obtained data are inseparable - if the experiment is designed properly, the resulting data will be valid for proper analysis and statistical inference .

What detection methods are most effective for studying the localization and expression levels of srd-26?

Multiple complementary methods should be employed for robust detection of srd-26:

  • Immunohistochemistry/Immunofluorescence: For epitope-tagged srd-26, commercial antibodies against the tag (such as HA) can be used to visualize receptor localization in tissue sections or cells . This circumvents the challenge of generating highly selective antibodies against GPCRs themselves.

  • Western blotting: For quantitative assessment of protein expression levels.

  • In situ hybridization: To detect mRNA expression in specific tissues.

  • Reporter gene systems: Consider generating knock-in mice where a reporter gene is inserted at the srd-26 locus to track expression patterns.

The approach using epitope tagging (such as HA-tag) at the endogenous locus has proven successful for studying delta opioid receptors and can be adapted for srd-26 . This strategy allows for studying expression, localization, protein-protein interactions, and signal transduction using widely available anti-epitope antibodies, overcoming the limitation of low GPCR expression levels and lack of selective antibodies.

How can I generate a conditional knockout model for srd-26 to study tissue-specific functions?

Generating a conditional knockout model for srd-26 can be accomplished using a strategy similar to that described for the delta opioid receptor. The approach involves:

  • Design and implementation: Use the TALEN or CRISPR/Cas9 system to introduce LoxP sequences flanking critical exons of the srd-26 gene along with an epitope tag sequence . This allows for both detection of the receptor and its conditional deletion.

  • Validation steps: Confirm correct targeting by PCR genotyping and sequencing to verify the presence of both the epitope tag and LoxP sites at the intended genomic locations.

  • Breeding strategy: Cross the floxed srd-26 mice with mice expressing tissue-specific Cre recombinase to generate offspring with tissue-specific knockout of srd-26 .

  • Efficiency analysis: Verify tissue-specific deletion by analyzing receptor expression in target tissues versus control tissues using the epitope tag for detection.

This one-step generation of mice carrying both a tagged receptor and conditional allele is more efficient than generating separate mouse lines, saving time, reducing breeding costs, and providing a powerful tool to study in vivo functions .

What approaches can be used to study srd-26 signaling pathways and protein-protein interactions?

To elucidate srd-26 signaling pathways and protein interactions:

  • Co-immunoprecipitation studies: Utilize the epitope tag to pull down srd-26 and identify interacting proteins through mass spectrometry . This approach overcomes the challenge of the typically low expression levels of GPCRs.

  • Signaling assays: Measure second messenger production (cAMP, IP3, calcium) following receptor activation to determine G-protein coupling preferences.

  • Bioluminescence/Fluorescence Resonance Energy Transfer (BRET/FRET): To study dynamic protein-protein interactions in live cells.

  • Phosphoproteomic analysis: To identify downstream phosphorylation events triggered by receptor activation.

  • Randomized block design experiments: When studying multiple treatments or conditions that might affect srd-26 signaling, use this experimental design to control for variability and increase statistical power by grouping experimental units into blocks of similar units .

When analyzing signaling data, employ robust statistical methods appropriate for your experimental design, such as ANOVA for randomized block designs, to properly account for experimental variability .

How can conformational changes in srd-26 be studied during ligand binding and activation?

Understanding the conformational dynamics of srd-26 during activation requires specialized techniques:

  • Site-directed mutagenesis: Introduce mutations at key residues predicted to be involved in ligand binding or receptor activation.

  • Molecular dynamics simulations: Leverage computational approaches to model conformational changes.

  • Structural biology approaches:

    • X-ray crystallography of the receptor in different activation states

    • Cryo-electron microscopy to visualize different conformational states

    • NMR spectroscopy to detect dynamic changes in structure

  • Intramolecular FRET sensors: Engineer pairs of fluorophores into the receptor structure to detect distance changes during activation.

  • Accessibility studies: Use cysteine accessibility methods to determine which residues become exposed or buried during activation.

Design these experiments using a Latin Square Design when testing multiple factors that might influence conformational changes (e.g., different ligands, pH conditions, and membrane compositions) to efficiently control for multiple sources of variation simultaneously .

How should I design dose-response experiments to characterize srd-26 pharmacology?

When designing dose-response experiments for srd-26:

  • Experimental planning: Begin with a clear definition of your experimental units and treatments . For dose-response studies, ensure a wide concentration range spanning at least 3-4 log units.

  • Randomization approach: Use a completely randomized design (CRD) if experimental conditions are homogeneous, or a randomized block design (RBD) if there are identifiable sources of variation (such as different cell batches) .

  • Control implementation:

    • Include positive controls (known GPCR ligands with well-characterized responses)

    • Include negative controls (vehicle-only treatments)

    • Consider including a reference GPCR for comparative analysis

  • Replication strategy: Include both technical replicates (multiple wells of the same treatment) and biological replicates (experiments repeated with different batches of cells or tissue preparations) . A minimum of 3-4 biological replicates is recommended.

  • Data analysis method: Use nonlinear regression to fit dose-response curves and determine pharmacological parameters (EC50/IC50, Emax, Hill slope). Apply appropriate statistical tests to compare parameters between experimental groups.

Remember that if a large number of treatments are being compared, randomized block design is preferable to completely randomized design as it can control for variability between blocks and increase the precision of your comparisons .

What factors should be considered when optimizing transfection or expression systems for studying recombinant srd-26?

When optimizing expression systems for srd-26:

  • Expression system selection:

    • Mammalian cell lines that naturally express GPCR machinery

    • Inducible expression systems to control expression levels

    • Stable cell lines vs. transient transfection (consider experimental needs)

  • Optimization parameters:

    • Codon optimization for the host species

    • Signal peptide optimization for proper membrane targeting

    • Consideration of epitope tag position (N-terminus, C-terminus, or internal)

    • Post-translational modification requirements

  • Experimental design structure: Implement a factorial design to systematically test multiple variables simultaneously (transfection reagent, DNA concentration, cell density, etc.) . This allows for identification of not just main effects but also interaction effects between variables.

  • Quality control metrics:

    • Surface expression quantification

    • Functional validation through signaling assays

    • Protein folding assessment

  • Source data verification: Implement proper SDV procedures to ensure the accuracy and reliability of your expression data, which is critical for downstream experiments .

How can I efficiently screen for potential srd-26 ligands?

For efficient ligand screening approaches:

  • High-throughput screening design:

    • Develop a robust assay with high signal-to-noise ratio

    • Implement appropriate controls on each plate

    • Consider Z-factor calculations to assess assay quality

  • Primary screening methodology:

    • Calcium flux assays for Gq-coupled responses

    • cAMP assays for Gs/Gi-coupled responses

    • β-arrestin recruitment assays

    • Membrane potential assays

  • Statistical considerations: Implement appropriate statistical methods for hit identification, including calculation of robust Z-scores and consideration of false discovery rates .

  • Confirmation strategy:

    • Dose-response testing of primary hits

    • Secondary orthogonal assays to confirm activity

    • Counter-screening against related receptors to assess selectivity

  • Risk-based quality management: Apply RBQM principles to focus monitoring and oversight activities on those screening processes most likely to affect data quality, enabling quick identification and mitigation of issues before they compromise your screening outcomes .

How should I analyze and interpret contradictory results in srd-26 signaling studies?

When facing contradictory results in srd-26 signaling studies:

  • Methodological comparison: Systematically compare experimental conditions between studies, including:

    • Cell types and expression systems used

    • Assay readouts and time points

    • Buffer compositions and temperatures

    • Receptor constructs (tagged vs. untagged)

  • Biological explanations to consider:

    • Receptor coupling to multiple G-protein subtypes

    • Biased signaling depending on ligand or cellular context

    • Receptor heterodimerization affecting signaling

    • Post-translational modifications altering receptor function

  • Validation approach: Design experiments that directly address the contradictions, such as:

    • Side-by-side comparison of methods

    • Using multiple assays to measure the same signaling pathway

    • Genetic approaches to eliminate specific signaling components

  • Statistical reassessment: Re-evaluate the statistical methods used, ensuring appropriate experimental design and analysis for the specific question . Consider power calculations to determine if sample sizes were adequate.

  • Source data review: Implement thorough SDR processes to ensure data quality and identify potential sources of discrepancies in the contradictory results .

What are the best practices for ensuring reproducibility in srd-26 research?

To maximize reproducibility in srd-26 research:

  • Experimental design documentation:

    • Clearly define and document all experimental parameters

    • Use randomization and blinding where appropriate

    • Implement positive and negative controls in every experiment

    • Include all necessary validation steps

  • Methodology standardization:

    • Develop and follow standard operating procedures (SOPs)

    • Characterize critical reagents (antibodies, cell lines, ligands)

    • Validate assay performance with reference compounds

  • Data management practices:

    • Implement proper source data verification (SDV) procedures to ensure data accuracy

    • Maintain complete records of raw data

    • Use electronic data capture systems when possible

  • Reporting standards:

    • Follow field-specific reporting guidelines

    • Report negative and positive results

    • Include all statistical analyses and raw data when possible

    • Clearly describe all exclusion criteria

  • Collaboration and independent validation:

    • Confirm key findings in independent laboratories

    • Consider multi-lab validation studies for critical discoveries

How does research funding allocation in GPCR studies compare to other molecular research areas?

  • Industry investment trends:
    Based on available R&D funding data, we can see significant investment in applied research across multiple industries. In 2019, all industries spent approximately $74,031 million on applied research . This substantial investment reflects the importance placed on research with potential applications, including GPCR studies that have direct therapeutic relevance.

  • Comparative funding allocation:
    The chemical industry, which encompasses much of pharmaceutical research, showed significant R&D investment with $97,063 million in 2019 . This sector includes GPCR research due to the importance of these receptors as drug targets.

  • Historical funding trajectory:
    R&D spending has shown consistent growth across industries, with total business R&D increasing from $278,977 million in 2010 to $492,956 million in 2019 . This upward trajectory suggests growing support for molecular research areas including GPCR studies.

  • Strategic funding approaches:
    When seeking funding for srd-26 research, consider:

    • Highlighting the therapeutic potential, as GPCRs represent approximately 36% of current drug targets

    • Emphasizing novel methodological approaches

    • Demonstrating preliminary data showing feasibility

    • Proposing collaborations that leverage complementary expertise

  • Resource optimization:
    Given funding limitations, implement risk-based approaches to maximize research output by focusing resources on the most critical aspects of your research protocol .

What emerging technologies hold promise for advancing srd-26 research?

Several cutting-edge technologies are poised to revolutionize srd-26 and general GPCR research:

  • CRISPR-based technologies:

    • Base editing for precise modification of srd-26 at the endogenous locus

    • Prime editing for installing specific mutations without double-strand breaks

    • CRISPR activation/interference systems to modulate endogenous expression

  • Advanced imaging techniques:

    • Super-resolution microscopy for visualizing receptor dynamics in native tissues

    • Single-molecule tracking to observe receptor movement and clustering

    • Expansion microscopy to physically enlarge specimens for improved resolution

  • Artificial intelligence applications:

    • Machine learning for prediction of ligand-receptor interactions

    • Deep learning for analysis of complex signaling networks

    • AI-assisted experimental design to optimize research parameters

  • Organoid and tissue-specific models:

    • 3D tissue cultures expressing srd-26 in physiologically relevant contexts

    • Patient-derived organoids for personalized medicine applications

    • Tissue-specific conditional knockout models using advanced genetic tools

  • Structural biology advances:

    • Cryo-EM for capturing different conformational states

    • Improved computational methods for predicting protein structure and dynamics

    • Novel labeling strategies for studying receptor conformation

Implement proper experimental design principles when evaluating these new technologies, including appropriate controls and statistical analyses to validate their effectiveness compared to established methods .

How can we integrate multi-omics approaches to better understand srd-26 function in complex biological systems?

Integrating multi-omics approaches provides a comprehensive understanding of srd-26 function:

  • Experimental design for multi-omics studies:

    • Plan synchronized sample collection for different omics analyses

    • Include appropriate time points to capture dynamic responses

    • Design experiments with sufficient biological replicates for statistical power

    • Consider nested experimental designs to account for technical and biological variation

  • Integration methodology:

    • Genomics: Identify genetic variants affecting srd-26 expression or function

    • Transcriptomics: Map downstream gene expression changes upon receptor activation

    • Proteomics: Characterize the receptor interactome and signaling complexes

    • Metabolomics: Identify metabolic pathways affected by receptor signaling

    • Phosphoproteomics: Map signaling cascades activated by receptor stimulation

  • Data analysis strategies:

    • Implement pathway analysis to identify enriched biological processes

    • Use network analysis to discover connections between different omics layers

    • Apply machine learning approaches to predict functional outcomes

  • Validation approaches:

    • Confirm key findings using orthogonal experimental approaches

    • Use genetic manipulation to test causality of identified pathways

    • Apply source data verification principles to ensure data quality across platforms

  • Collaborative framework:

    • Establish interdisciplinary teams with expertise in different omics technologies

    • Develop standardized protocols for sample processing and data analysis

    • Implement data sharing practices that facilitate integrated analysis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.