Recombinant Serpentine receptor class delta-2 (srd-2)

Shipped with Ice Packs
In Stock

Description

Key Properties:

PropertyDetail
Source OrganismCaenorhabditis elegans
Expression SystemE. coli, yeast, baculovirus, or mammalian cells
Purity>95% (SDS-PAGE verified)
ApplicationsWestern blot (WB), ELISA, functional assays
StorageLyophilized or liquid form at -20°C; avoid freeze-thaw cycles

Functional and Biological Context

While the endogenous role of srd-2 in C. elegans remains less characterized compared to other serpentine receptors (e.g., srd-25 ), GPCRs in this nematode are broadly implicated in chemosensation, synaptic plasticity, and developmental signaling . For example:

  • Serpentine receptors in C. elegans regulate responses to mechanical, thermal, and chemical cues .

  • Mutations in related receptors (e.g., sdn-1) disrupt Wnt-dependent spindle orientation during embryogenesis .

The recombinant srd-2 protein enables researchers to study its ligand-binding properties and signaling mechanisms in vitro, though direct functional data for srd-2 remain limited .

Research Applications

Recombinant srd-2 is primarily utilized as a reagent for:

  • Antibody Production: Generating antibodies for immunohistochemistry or Western blotting .

  • Pathway Analysis: Investigating GPCR-mediated signaling cascades in heterologous systems.

  • Structural Studies: Mapping receptor domains involved in ligand interactions .

Notably, C. elegans serpentine receptors are evolutionarily conserved, making srd-2 a proxy for studying human GPCR dysfunction linked to diseases like cancer or neurodegeneration .

Challenges and Future Directions

Current limitations include the lack of full-length srd-2 constructs and validated ligands. Future studies could:

  • Characterize srd-2’s role in C. elegans behavior or development via knockout models.

  • Screen for small-molecule modulators using recombinant srd-2 in high-throughput assays .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize development accordingly.
Synonyms
srd-2; R05H5.1; Serpentine receptor class delta-2; Protein srd-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-362
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
srd-2
Target Protein Sequence
MNNTIQNSTITDDLKYVMTLDKLTEYLSCLICLPGALCNAILIYLIWKRTPIQMRSYAIY ILNFALFDFATCIISFFSCQQVIFSDFSLVYIFHGPCKYVSPWFCYFCHCFMCHALAHSQ WILLGSFIYRYRVLTGETPTAKDLIRNSVALYSMSLCFLLVYVFDNSDSDLLFQILTRVH PEYHYDDESIWKKSIVVSGNISAFAPITLISILYMTIPCVPIYCAILYFRHNTRVILNNP HINLSPTAKSNHVKLIRALTVQAGIPIFWLVASGIFTMSQFGIIGGPIPENITFRLMDCI PLISPIVTIIFVQPYREGLLKVLLKNSGLFVPNIIGSSIVDQTVAVTSVFGPKVTAFVQT QL
Uniprot No.

Target Background

Function
This protein is thought to be a chemosensory receptor.
Database Links

KEGG: cel:CELE_R05H5.1

UniGene: Cel.28758

Protein Families
Nematode receptor-like protein srd family
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.