Recombinant Serpentine receptor class delta-32 (srd-32)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Serpentine Receptor Class Delta-32 (srd-32)

Recombinant Serpentine receptor class delta-32 (srd-32) is a protein-coding gene product derived from Caenorhabditis elegans, a model nematode organism. The protein is produced via recombinant DNA technology, typically expressed in E. coli for structural and functional studies . It belongs to the serpentine (G-protein-coupled receptor, GPCR) family, which is characterized by a seven-transmembrane domain structure. While its exact biological role remains incompletely understood, its recombinant form is utilized in research to study receptor signaling, ligand interactions, and developmental processes in C. elegans .

Gene Information

AttributeValueSource
Gene Symbolsrd-32
Entrez Gene ID191815
Full NameSerpentine receptor class delta-32
OrganismCaenorhabditis elegans
mRNA SequencesNM_071902.3, NM_071902.4
Protein SequencesNP_504303.1

Functional Insights

While specific signaling pathways are not well-documented, serpentine receptors in C. elegans are often implicated in:

  • Developmental regulation: Modulating cell fate or migration during embryogenesis.

  • Neurotransmission: Interacting with endogenous ligands to influence neural circuits.

  • Environmental sensing: Responding to extracellular cues (e.g., chemokines, hormones).

Research Applications and Uses

Recombinant srd-32 is primarily used in:

  1. Protein interaction studies: Identifying binding partners via co-IP or pull-down assays.

  2. Functional assays: Testing receptor activation or desensitization in vitro.

  3. Structural studies: Crystallization or cryo-EM for 3D structure determination.

Handling Precautions

  • Avoid repeated freeze-thaw cycles.

  • Reconstitute to 0.1–1.0 mg/mL concentration .

Table 1: Gene and Protein Overview

AttributeValue
Gene TypeProtein-coding
mRNA Length~1,020 bp (ORF)
Protein Molecular Weight~37 kDa (estimated)

Table 2: Recombinant Protein Production

AttributeValue
Expression VectorpcDNA3.1-C-(K)DYK
Cloning MethodCloneEZ™ Seamless Technology
Insert StructureLinear

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
srd-32; T19H12.5; Serpentine receptor class delta-32; Protein srd-32
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
srd-32
Target Protein Sequence
MFVDIYDQLYISYAAVVSTLGIIFNGFLLFLIFFKSPSCLTPYTVFLANTSITQLGYCIC FLLTVPRVISINLRIVNIYLGFSQFLGHWWSYMIFTTMLHFAVNSFLSIMLSMVFRCISL KTLRFPTSGAFAMCILAYMIPLSMVVSIRGIEITSNFTINSKYTLWQLENLDKYRTVVGT TMAQLSTLWVACCVSILCIPIYSVMFWCRYRILRMLERPGYMFNTTTTLQIKRLVKALTV QSLIPVFTLFPASLIFLSTQFHVIETTKFGYIIISLLSLSPTIDPLVTIYYVQPYRKYIV DLLWSEERPMVSPFLSNNDPRFYRSRSNSVLMMRNTHFV
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_T19H12.5

UniGene: Cel.2722

Protein Families
Nematode receptor-like protein srd family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of serpentine receptor class delta-32?

Serpentine receptors are G-protein coupled receptors (GPCRs) that play crucial roles in cell signaling pathways. The delta-32 variant, exemplified by CCR5-delta32, represents a significant polymorphism with functional consequences. In the case of CCR5-delta32, this 32 base-pair deletion in the coding region alters receptor expression and function. The CCR5 receptor normally functions as a chemokine receptor expressed on macrophages, monocytes, T cells, and dendritic cells, serving as a specific receptor for CC ligand 3 (CCL3), CCL4, and CCL5 chemokines . This receptor plays a key role in the migration of immune cells to inflammatory sites and, significantly, serves as a co-receptor for HIV-1 entry into cells .

How are genetic polymorphisms in serpentine receptors identified and characterized?

Genetic polymorphisms in serpentine receptors are typically identified through DNA sequencing, PCR-based genotyping, and case-control genetic studies. For example, in studies of CCR5-delta32, researchers employed comprehensive literature searches across databases including PubMed, EMBASE, CNKI, Cochrane Library, and WanFang to identify relevant case-control studies . The polymorphism is characterized through genotyping to identify homozygous wild-type (AA), heterozygous (AB), and homozygous variant (BB) genotypes. Statistical analysis using odds ratios (ORs) with 95% confidence intervals helps quantify the association between the polymorphism and biological outcomes .

What are the methodological considerations for expressing recombinant serpentine receptors in laboratory settings?

When expressing recombinant serpentine receptors:

  • Select appropriate expression systems: Cell lines like CHO (Chinese Hamster Ovary) cells are commonly used for successful expression of functional receptors .

  • Verify receptor functionality: Confirm proper expression through signaling assays, such as measuring G-protein coupling. For example, pertussis toxin sensitivity tests can verify Gi/o protein involvement .

  • Establish stable transfection: Create stably transfected cell lines for consistent receptor expression levels across experiments.

  • Validate expression: Use techniques such as Western blotting, flow cytometry, or radioligand binding assays to confirm and quantify receptor expression.

  • Assess downstream signaling: Measure activation of relevant pathways, such as MAPK cascades or adenylyl cyclase inhibition, to verify receptor functionality .

What are the optimal study designs for investigating serpentine receptor polymorphisms and their functional outcomes?

Based on established methodologies for serpentine receptor variants like CCR5-delta32, optimal study designs include:

  • Case-control studies: Compare genotype frequencies between affected individuals and controls. For example, in studying CCR5-delta32, researchers included 4,786 HIV-1 infected patients and 6,283 controls across 24 case-control studies .

  • Exposed-unexposed comparisons: Include subjects exposed to relevant conditions but who remain unaffected (e.g., exposed uninfected individuals in HIV studies).

  • Meta-analysis approach: Pool data from multiple studies to increase statistical power and resolve inconsistencies across individual studies. This approach should include:

    • Comprehensive literature search with clear inclusion criteria

    • Quality assessment of included studies

    • Calculation of pooled odds ratios with confidence intervals

    • Heterogeneity assessment (using I² statistics)

    • Sensitivity analysis to evaluate result robustness

    • Publication bias assessment using methods like Begg's and Egger's tests

How should researchers design experiments to investigate signaling pathways associated with serpentine receptor variants?

When designing experiments to investigate signaling pathways:

  • Use both recombinant and non-recombinant cellular systems to confirm physiological relevance.

  • Employ pertussis toxin sensitivity assays to determine G-protein coupling specificity. For instance, CB2 receptor signaling has been shown to be pertussis toxin-sensitive, indicating Gi/o protein involvement .

  • Measure multiple downstream effectors, as some pathways may be cell-type specific. For example, while ERK1/2 activation is consistently observed across different cell types, adenylyl cyclase inhibition may vary .

  • Include phosphorylation studies of relevant transcription factors (e.g., Krox-24) to assess control of gene transcription .

  • Validate findings in primary cells relevant to the receptor's physiological context, such as immune cells, microglia, or macrophages for immunologically relevant receptors .

  • Use selective antagonists and knockout models to confirm pathway specificity.

What statistical approaches are most appropriate for analyzing genotype-phenotype associations in serpentine receptor research?

Based on established methodologies in the field:

  • Calculate odds ratios (ORs) with 95% confidence intervals to quantify association strength between genotypes and phenotypes.

  • Apply appropriate genetic models for analysis:

    • Allele frequency comparison (B vs. A)

    • Heterozygote comparison (AB vs. AA)

    • Homozygote comparison (BB vs. AA)

    • Dominant model (AB+BB vs. AA)

    • Recessive model (BB vs. AA+AB)

  • Perform stratification analysis by:

    • Ethnicity (e.g., Caucasian, Asian, Mixed populations)

    • Exposure status (e.g., exposed uninfected vs. healthy controls)

  • Address heterogeneity using:

    • I² statistics to quantify heterogeneity

    • Random-effects models when heterogeneity is significant (I²>50% or P<0.10)

    • Fixed-effects models when heterogeneity is not significant

  • Conduct sensitivity analysis by sequentially excluding individual studies to assess result robustness.

  • Assess publication bias using Begg's funnel plot and Egger's test .

How do homozygous versus heterozygous serpentine receptor variants differ in their functional consequences?

Research on CCR5-delta32 demonstrates significant functional differences between heterozygous and homozygous variants:

  • Homozygous variant (delta32/delta32):

    • Provides substantial protection against HIV-1 infection (OR=0.25, 95%CI=0.09-0.68, P=0.006)

    • Effect is particularly strong in exposed uninfected populations (OR=0.06, 95%CI=0.01-0.32, P=0.001)

    • Shows consistent protective effect across ethnic groups, particularly in Caucasian populations (OR=0.22, 95%CI=0.07-0.69, P=0.009)

  • Heterozygous variant (wt/delta32):

    • Surprisingly associated with increased HIV-1 susceptibility in some populations (OR=1.16, 95%CI=1.02-1.32, P=0.024)

    • Does not confer significant protection in exposed uninfected populations (OR=0.91, 95%CI=0.66-1.25, P=0.568)

This differential effect highlights the complexity of receptor function and suggests that partial receptor expression (in heterozygotes) may create different biological outcomes compared to complete absence (in homozygotes).

What approaches can resolve contradictory findings in serpentine receptor research?

To resolve contradictions in research findings:

  • Conduct meta-analyses with proper subgroup analyses. For example, the CCR5-delta32 meta-analysis revealed different effects in different comparison groups (healthy controls vs. exposed uninfected) .

  • Stratify analyses by ethnicity to account for population-specific effects. The CCR5-delta32 polymorphism showed significant associations in Caucasian populations but not necessarily in all ethnic groups .

  • Consider different genetic models (dominant, recessive, etc.) as effects may be model-specific.

  • Account for environmental exposures and co-factors that may modify genetic effects.

  • Implement sensitivity analyses to identify influential studies that may be driving contradictory results.

  • Assess methodology quality across studies, as variations in genotyping methods, case definitions, or control selection may contribute to discrepant findings.

  • Evaluate publication bias systematically, as negative results may be underrepresented in the literature .

How should researchers interpret population-specific differences in serpentine receptor variant frequencies and effects?

When interpreting population-specific differences:

  • Consider evolutionary selection pressure: The prevalence of protective variants like CCR5-delta32 may reflect historical selection pressures from infectious diseases.

  • Examine genotype distribution patterns: The table below shows significant variation in delta32 allele frequency across populations:

EthnicityDelta32 Allele Presence in ControlsFunctional Implications
CaucasianPresent in substantial numbers (5-14%)Significant protective effect in homozygotes
AsianVery rare (0-1.5%)Limited population impact due to rarity
Mixed populationsIntermediate frequencyVariable effects depending on admixture
  • Account for different genetic backgrounds: The functional impact of a receptor variant may be modified by other genetic factors that differ across populations.

  • Consider exposure differences: Population-specific environmental or pathogen exposure may influence the observed effect of receptor variants .

What are the key considerations when analyzing genotype data from case-control studies of serpentine receptor variants?

Key considerations include:

  • Ensure Hardy-Weinberg Equilibrium (HWE) in control populations to validate genotyping accuracy.

  • Assess genotype distribution across different study populations, as shown in this table from CCR5-delta32 research:

AuthorEthnicityHIV-1 infectedHealthy ControlsExposed uninfected
AAABBB
TanAsians226241
RathoreAsians19000
LiuCaucasian261550
ZimmermanCaucasian6011440
WangAsians10400
TiensiwakulAsians11600

(AA: CCR5 wild-type homozygotes; AB: CCR5-delta32 heterozygotes; BB: delta32 homozygotes)

  • Compare results across different control types (healthy controls vs. exposed uninfected) to identify context-dependent effects.

  • Calculate appropriate effect sizes using consistent statistical models. For example:

  • Report heterogeneity metrics (I²) alongside effect estimates to indicate result reliability .

What future research directions should be prioritized in the field of serpentine receptor variants?

Priority research directions should include:

  • Multi-ethnic studies with larger sample sizes to address limitations in current research. As noted in the CCR5-delta32 meta-analysis, many studies had limited sample sizes and focused on specific ethnic groups .

  • Investigation of gene-environment interactions, including how lifestyle factors modify the effects of receptor variants.

  • Functional studies examining the molecular mechanisms behind observed genetic associations, particularly the paradoxical effects seen in heterozygotes versus homozygotes.

  • Exploration of therapeutic applications based on receptor variant function. For example, the protective effect of CCR5-delta32 against HIV-1 suggests potential therapeutic targets .

  • Development of improved recombinant expression systems that better replicate physiological receptor function and signaling.

  • Integration of receptor variant data with broader -omics approaches (transcriptomics, proteomics, metabolomics) to understand system-level effects.

  • Longitudinal studies to assess how receptor variants influence disease progression and treatment outcomes over time.

How should researchers synthesize contradictory findings about serpentine receptor variants?

Researchers should approach contradictory findings by:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.