Recombinant Serpentine receptor class delta-33 (srd-33)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly indicate it in your order remarks. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is decided during production. If you have a preferred tag type, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
srd-33; T19H12.4; Serpentine receptor class delta-33; Protein srd-33
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
srd-33
Target Protein Sequence
MPILRSVAAVLAPFTSDTYMNTADSIFVITVTILTSIGFLLNLLLLYLIIWKSPRNLTPY RIFLANTTITQLVYALFAVTSMPRVLAKHQYTIVIYLGPVQFFGEWFSYMSYVGILHLSL NSFISLMLSMIYRYFSIRFKRFTANTSIILCIIGYFFPFLIFASCSNIAISSSLSFNTAV LDGMVENLESYHMVLTTEISNHPSLIILTLAVTCGLVPIYFVMYWCRHQIHKTLKQTRSV HSPSTRDNARRLVRALTIQSIIPLVSVFPASIFWCLSQLGFVEPTMYSYFIIPCLSLGCI ADPVVTIRCVLPYRRWILKLCNMSTTDMITSNQDKSTIFQKH
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_T19H12.4

UniGene: Cel.2721

Protein Families
Nematode receptor-like protein srd family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Serpentine receptor class delta-33 (srd-33) and where is it expressed?

Serpentine receptor class delta-33 (srd-33) is a transmembrane protein belonging to the G protein-coupled receptor (GPCR) superfamily found in Caenorhabditis elegans. The protein is encoded by the srd-33 gene, also identified as T19H12.4 in ORF nomenclature. It consists of 342 amino acids and is characterized by its seven-transmembrane domain structure typical of GPCRs. The expression region spans positions 1-342 of the protein sequence, with the full amino acid sequence containing distinctive transmembrane regions and extracellular/intracellular loops important for its signaling function .

How should recombinant srd-33 protein be stored to maintain stability?

For optimal stability, recombinant srd-33 protein should be stored at -20°C in a Tris-based buffer containing 50% glycerol. For extended storage periods, conserving the protein at -80°C is recommended. Working aliquots can be maintained at 4°C for up to one week, but repeated freezing and thawing cycles should be avoided as they may compromise protein integrity. When preparing working dilutions, it's advisable to use fresh aliquots rather than repeatedly accessing the stock solution .

What experimental controls should be included when working with recombinant srd-33?

When designing experiments with recombinant srd-33, researchers should implement several controls to ensure valid and reliable results:

  • Negative controls: Buffer-only samples to account for background signal

  • Positive controls: Well-characterized proteins from the same family with established activity profiles

  • Concentration gradients: Serial dilutions to establish dose-dependent effects

  • Time-course measurements: Multiple time points to capture temporal dynamics

  • Validation controls: Using alternative detection methods to confirm observations

These controls help mitigate experimental artifacts and increase confidence in research findings. For reproducibility, implementing single-case experimental designs with randomization can further strengthen the validity of results related to protein function .

How can researchers effectively design experiments to characterize the binding partners of srd-33?

Characterizing binding partners of srd-33 requires a multi-faceted experimental approach:

  • Co-immunoprecipitation (Co-IP): Using anti-srd-33 antibodies to pull down the protein along with its binding partners, followed by mass spectrometry to identify interacting proteins. This technique has been effectively used for other receptors like ST2 and TRPM8 .

  • Yeast two-hybrid screening: Creating fusion constructs of srd-33 domains to identify potential interacting partners from C. elegans cDNA libraries.

  • Biolayer interferometry or surface plasmon resonance: These label-free technologies can quantitatively measure binding kinetics between srd-33 and potential ligands or receptors.

  • FRET/BRET assays: For detecting interactions in living cells, these energy transfer techniques can reveal proximity-based interactions between fluorescently tagged srd-33 and candidate partners.

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry to capture transient or weak interactions.

The experimental design should include appropriate controls for each technique, including scrambled peptides or related but distinct proteins to confirm specificity. Researchers should also consider implementing randomization in their experimental design to enhance internal validity, as demonstrated in other receptor studies .

What approaches can be used to investigate the functional significance of missense variants in srd-33?

Investigating the functional significance of missense variants in srd-33 requires a systematic approach similar to that used for other proteins like SynGAP1:

  • In silico prediction: Use computational tools to predict the impact of amino acid substitutions on protein structure and function.

  • Heterologous expression systems: Express wild-type and variant srd-33 in cell lines to compare expression levels, subcellular localization, and stability.

  • Electrophysiological measurements: For receptors like srd-33, patch-clamp recordings can assess changes in channel properties or downstream signaling.

  • Calcium imaging: Measure intracellular calcium responses to assess signaling capacity, similar to methods used for TRPM8 .

  • Protein interaction assays: Determine if variants affect binding to known partners using techniques such as co-immunoprecipitation.

  • CRISPR-based approaches: Generate C. elegans strains with specific variants to assess phenotypic outcomes.

This comprehensive approach allows researchers to determine which missense variants are likely pathogenic and understand the specific functional deficits they cause, similar to approaches used in SynGAP1 research where variants are assessed for impacts on protein interaction with key neuronal components .

How can researchers distinguish between direct and indirect effects when studying srd-33 signaling pathways?

Distinguishing between direct and indirect effects in srd-33 signaling requires thoughtful experimental design:

  • Temporal resolution studies: Capture signaling events at multiple time points (seconds, minutes, hours) to establish the sequence of events.

  • Pharmacological inhibition: Use selective inhibitors of known signaling components to block specific pathways and observe effects on downstream signaling.

  • Genetic approaches: Use RNA interference or CRISPR-based gene editing to selectively knock down or knock out components of the signaling pathway.

  • Reconstitution experiments: In cell-free systems, reconstruct signaling components to test direct interactions.

  • Proximity labeling techniques: Methods like BioID or APEX can identify proteins in close proximity to srd-33 during signaling.

  • Single-cell analyses: Examine cell-to-cell variability in signaling responses to identify direct responders versus population effects.

Implementing randomized experimental designs similar to those used in other receptor studies can strengthen the internal validity of these approaches and help control for confounding factors .

What are the optimal conditions for expressing and purifying recombinant srd-33 protein?

Optimal expression and purification of recombinant srd-33 requires careful consideration of several factors:

Expression Systems:

  • E. coli: Suitable for partial domains or soluble regions

  • Insect cells: Better for full-length protein with proper folding

  • Mammalian cells: Optimal for authentic post-translational modifications

Purification Strategy:

  • Affinity chromatography using appropriate tags (His, GST, etc.)

  • Size exclusion chromatography to remove aggregates

  • Ion-exchange chromatography for final polishing

Key Optimization Parameters:

  • Temperature: Lower temperatures (16-18°C) often yield better-folded protein

  • Induction conditions: IPTG concentration and timing significantly impact yield

  • Buffer composition: Must be optimized for protein stability

  • Detergent selection: Critical for membrane protein solubilization

For optimal results, researchers should perform small-scale expression tests varying these parameters before scaling up to production quantities. Quality control assessments should include SDS-PAGE, Western blotting, and activity assays to confirm proper folding and function .

What are the most effective approaches for investigating srd-33 localization and trafficking in cells?

Investigating srd-33 localization and trafficking requires specialized techniques:

  • Fluorescent protein tagging: Creating srd-33-GFP fusion constructs to track protein movement in live cells.

  • Immunofluorescence: Using antibodies specific to srd-33 or epitope tags for fixed-cell imaging.

  • Cell surface biotinylation: To specifically quantify membrane-localized protein.

  • TIRF microscopy: For high-resolution imaging of protein at the plasma membrane.

  • Photoactivatable or photoconvertible tags: To track specific protein populations over time.

  • Pulse-chase experiments: To follow newly synthesized protein through the secretory pathway.

  • Endocytosis assays: To measure internalization rates using antibody feeding or reversible biotinylation.

When analyzing results, researchers should be aware that tagging may alter trafficking properties. Controls with untagged protein detected by antibodies should be performed when possible. Quantitative analysis of colocalization with organelle markers is essential for conclusive localization studies .

What strategies can be employed to develop specific antibodies against srd-33?

Developing specific antibodies against srd-33 requires careful antigen design and validation:

Antigen Selection Strategies:

  • Peptide antigens: Target unique, hydrophilic regions of srd-33, preferably exposed loops

  • Recombinant protein fragments: Use soluble domains for immunization

  • Genetic immunization: DNA vaccines encoding srd-33 for in vivo expression

Production Approaches:

  • Polyclonal antibodies: Faster to generate but may have more cross-reactivity

  • Monoclonal antibodies: Higher specificity but more resource-intensive

  • Recombinant antibodies: Alternative approach using display technologies

Critical Validation Steps:

  • ELISA against immunizing antigen

  • Western blot analysis of recombinant protein and native samples

  • Immunoprecipitation to confirm specificity

  • Immunofluorescence with appropriate controls

  • Testing in knockout/knockdown systems to confirm specificity

  • Cross-reactivity testing against related proteins

Researchers should consider using multiple antibodies targeting different epitopes to confirm observations and implement rigorous validation protocols to ensure antibody specificity before use in critical experiments .

How can single-case experimental designs be applied to srd-33 research in C. elegans models?

Single-case experimental designs (SCEDs) can be powerfully applied to srd-33 research in C. elegans:

  • Randomized phase designs: Alternating baseline and intervention phases with randomized phase lengths to assess interventions targeting srd-33 function.

  • Multiple baseline designs: Staggered introduction of interventions across different worm populations to control for time-dependent effects.

  • Changing criterion designs: Systematically adjusting intervention intensity to establish dose-response relationships.

Implementation requires:

  • Precise measurement of relevant behavioral or physiological outcomes

  • Sufficient baseline stability before interventions

  • Repeated measurements within and across phases

  • Randomization of intervention timing when possible

Data analysis should combine visual analysis, effect size calculations, and randomization tests. This approach is particularly valuable for testing pharmacological compounds targeting srd-33 or for characterizing phenotypes of specific srd-33 variants. The approach offers strong internal validity while accommodating the individual variability often observed in receptor signaling studies .

What are the emerging techniques for studying the role of srd-33 in neuronal signaling?

Emerging techniques for studying srd-33 in neuronal signaling include:

  • Optogenetic approaches: Light-activated control of srd-33 activity using engineered light-sensitive domains.

  • Chemogenetic tools: Designer receptors exclusively activated by designer drugs (DREADDs) to manipulate srd-33 pathways.

  • Genetically encoded biosensors: FRET-based sensors to visualize signaling events downstream of srd-33 activation.

  • In vivo calcium imaging: GCaMP sensors to monitor neural activity patterns associated with srd-33 function.

  • Super-resolution microscopy: Techniques like STORM or PALM to visualize srd-33 clustering and organization at the nanoscale.

  • Single-molecule tracking: Following individual receptor molecules to understand dynamic behaviors.

  • Cryo-electron microscopy: Determining high-resolution structures of srd-33 in different conformational states.

These approaches can be integrated with genetic manipulations in C. elegans to provide comprehensive understanding of srd-33 function in its native context. Researchers should consider implementing randomized experimental designs when using these techniques to enhance internal validity .

How can researchers integrate data from multiple experimental approaches to build comprehensive models of srd-33 function?

Integrating data from multiple experimental approaches requires sophisticated strategies:

  • Data integration frameworks:

    • Hierarchical Bayesian models to combine data with different noise characteristics

    • Network analysis to identify relationships between different experimental outputs

    • Machine learning approaches to identify patterns across diverse datasets

  • Multi-scale modeling:

    • Molecular dynamics simulations of protein structure and dynamics

    • Kinetic models of signaling pathways

    • Agent-based models of cellular behaviors

    • Population-level models of organismal phenotypes

  • Collaborative platforms:

    • Standardized data formats for cross-laboratory comparisons

    • Open-access repositories for sharing raw data

    • Collaborative tools for annotating and interpreting complex datasets

  • Validation strategies:

    • Predictions from integrated models should be tested with new experiments

    • Sensitivity analysis to identify critical parameters and assumptions

    • Cross-validation across different experimental systems

This integrative approach allows researchers to build more robust models of srd-33 function that incorporate information from molecular, cellular, and organismal levels of analysis. The approach mirrors methods used in complex receptor studies like those for TRPM8 and ST2 interactions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.