Recombinant Serpentine receptor class delta-3 (srd-3)

Shipped with Ice Packs
In Stock

Description

Overview and Classification

Serpentine receptor class delta-3 (srd-3) is a specialized membrane protein found in the nematode Caenorhabditis elegans. This protein belongs to the broader family of G protein-coupled receptors (GPCRs), characterized by their seven-transmembrane domain structure. The receptor is encoded by the srd-3 gene, also identified in scientific literature as K10B4.5. The protein's official UniProt ID is O17240, which serves as its unique identifier in protein databases . Serpentine receptors in C. elegans represent one of the largest gene families in the organism, with the srd class being particularly abundant and diverse in function and expression patterns.

Evolutionary Significance

Serpentine receptors represent an evolutionarily conserved protein family that has diversified extensively in nematodes. The delta class, to which srd-3 belongs, exhibits specific sequence characteristics that distinguish it from other serpentine receptor classes. These receptors have evolved to detect various environmental and internal signals, contributing to the nematode's ability to respond to its surroundings. The study of srd-3 provides valuable insights into receptor evolution and specialization in simple organisms, which may have implications for understanding more complex sensory systems in higher organisms.

Functional Role in C. elegans

In C. elegans, serpentine receptors like srd-3 are primarily involved in chemosensation, allowing the nematode to detect and respond to chemical stimuli in its environment. These receptors are often expressed in specific sensory neurons and play critical roles in behaviors such as chemotaxis, food detection, and mate finding. While the exact ligands and downstream signaling pathways for srd-3 have not been fully characterized, its structural features suggest a role in environmental sensing. The receptor's expression patterns and potential interactions with other cellular components provide clues about its biological function in the nematode's sensory system.

Secondary and Tertiary Structure

While detailed three-dimensional structural information for srd-3 is limited, computational predictions based on its amino acid sequence suggest a canonical GPCR fold. The protein is expected to form seven transmembrane α-helices connected by intracellular and extracellular loops. The N-terminus is predicted to be extracellular, while the C-terminus is likely intracellular, consistent with the typical topology of serpentine receptors. The transmembrane domains are predominantly hydrophobic, facilitating their embedding in the lipid bilayer of the cell membrane. These structural features are essential for the receptor's function in sensing external stimuli and transducing signals to intracellular pathways.

Purification Techniques

The purification of recombinant srd-3 typically involves affinity chromatography, taking advantage of the His tag fused to the N-terminus of the protein. This approach allows for selective binding of the tagged protein to a nickel or cobalt resin, with subsequent elution using imidazole or low pH conditions. Following affinity purification, additional steps such as size exclusion chromatography or ion exchange chromatography may be employed to achieve higher purity. The purified protein is then subjected to quality control measures, including SDS-PAGE analysis, which has confirmed purity levels greater than 90% for commercial preparations .

Reconstitution Protocols

Proper reconstitution of lyophilized srd-3 protein is critical for maintaining its structural integrity and functionality. The recommended protocol involves:

  1. Brief centrifugation of the vial before opening to bring contents to the bottom

  2. Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Addition of glycerol to a final concentration of 5-50% (with 50% being the default recommendation)

  4. Aliquoting for long-term storage at -20°C/-80°C

This approach minimizes protein degradation and maintains sample homogeneity. The addition of glycerol serves as a cryoprotectant, preventing ice crystal formation that could damage the protein structure .

Stability Considerations

Serpentine receptors, being membrane proteins, present particular challenges for stability in vitro. Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and aggregation. The presence of trehalose (6%) in the storage buffer enhances protein stability by protecting against both freezing and dehydration stresses. For experiments requiring repeated access to the protein, working aliquots should be prepared and stored at 4°C for no more than one week to minimize degradation. These stability considerations are essential for ensuring reliable experimental results when working with this recombinant protein .

Functional Characterization

The recombinant srd-3 protein provides opportunities for investigating the receptor's functional properties. While specific ligands for srd-3 have not been definitively identified, the purified protein can be used in binding assays with candidate molecules to discover potential natural or synthetic ligands. Incorporation of the protein into artificial membrane systems, such as liposomes or nanodiscs, could enable functional reconstitution for downstream signaling studies. These approaches may shed light on the receptor's role in C. elegans sensory perception and its potential involvement in behaviors such as chemotaxis, foraging, or mate finding.

Antibody Production and Immunological Studies

Purified recombinant srd-3 serves as an excellent antigen for the production of specific antibodies. These antibodies can be valuable tools for detecting the native protein in C. elegans tissues, studying its expression patterns through immunohistochemistry, or investigating its interactions with other proteins via co-immunoprecipitation. Furthermore, antibodies against srd-3 could be used to disrupt receptor function in vivo, providing insights into its physiological roles. The availability of highly purified recombinant protein ensures the generation of specific antibodies with minimal cross-reactivity to other serpentine receptors.

Relationship to Other Serpentine Receptors

The srd-3 protein is one member of the diverse serpentine receptor family in C. elegans, which includes several classes (srh, sri, srj, etc.) with varying sequence characteristics and potential functions. Comparative analysis of srd-3 with other members of the delta class and with serpentine receptors from other classes can provide insights into the evolution and specialization of these sensory proteins. Such comparisons may reveal conserved motifs important for general receptor function as well as unique features that confer specificity to srd-3. These analyses contribute to our understanding of how receptor diversity enables the nematode to respond to a wide range of environmental stimuli.

Homologs in Other Species

While srd-3 is specific to C. elegans, homologous proteins may exist in other nematode species and possibly in more distantly related organisms. Identification and characterization of these homologs can provide evolutionary context for understanding srd-3 function. Additionally, comparison with structurally similar receptors in other organisms, including humans, may reveal insights into conserved mechanisms of GPCR signaling and sensory perception. Such comparative studies are facilitated by the availability of recombinant proteins for structural and functional analysis.

Relevance to Human Biology

Although srd-3 is a nematode-specific protein, studies of this receptor may have implications for understanding human biology. The basic mechanisms of GPCR signaling are conserved across species, and insights gained from studying srd-3 may be applicable to human GPCRs involved in sensory perception, neurotransmission, or other processes. Furthermore, C. elegans serves as an important model organism for studying fundamental biological processes, and characterization of its sensory receptors contributes to our understanding of how organisms perceive and respond to their environment, which has relevance across species.

Identification of Natural Ligands

A significant gap in our current knowledge about srd-3 is the identity of its natural ligands. Future research efforts could focus on screening libraries of small molecules, peptides, or natural extracts to identify compounds that specifically bind to and activate the receptor. High-throughput approaches combined with functional assays in heterologous expression systems or in reconstituted membrane environments could accelerate this discovery process. Identification of srd-3 ligands would not only enhance our understanding of its biological function but also potentially provide tools for manipulating receptor activity in experimental settings.

In Vivo Functional Studies

Complementary to in vitro studies with the recombinant protein, future research should also address the in vivo function of srd-3 in C. elegans. Advanced genetic techniques such as CRISPR-Cas9 could be used to generate specific mutations or reporter constructs to study the receptor's expression, localization, and function in living nematodes. Behavioral assays combined with calcium imaging or other methods for measuring neuronal activity could reveal how srd-3 contributes to the nematode's sensory capabilities and behavioral responses. These in vivo approaches would provide contextual information that complements the molecular insights gained from studies with the recombinant protein.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for the specific delivery timeframe.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as an additional fee will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
srd-3; K10B4.5; Serpentine receptor class delta-3; Protein srd-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
srd-3
Target Protein Sequence
MNATNLQLISHAQKIDHVFKIIGYIVNPLGILFNTLLIILISTKTPKLLQSYSMLHLNFA LCDLFSCLAGMLALQKIVFSGWSLTYIFHGACGQISSYFCYFLHVFVCHCLAHSQWILMI SFLYRYYILDQISPDTVKIVRICILTYLPSLLFVIVYWSDVANEDALKRIVNSFHPEYIY DSKEIWGDLVIAGNMSCWSAATFSAIVYMTIPCFPIYGVIVFFRHKTLKSLDGRGRITMS ETTRSSHKQLIKALTIQAIVPIFWLTASTFYLLALFQVVGRVIVENMPFRIMECMPMITP LISLYFVRPYRSALTGWFFPTSLLKPVIASAMLSSTAASVAPTP
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_K10B4.5

STRING: 6239.K10B4.5

UniGene: Cel.14764

Protein Families
Nematode receptor-like protein srd family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How should expression systems be selected for recombinant srd-3 studies?

The selection of an appropriate expression system is critical for successful characterization of recombinant receptors. Based on approaches used with similar receptors, Xenopus oocytes represent a well-established system for initial functional characterization due to their robust protein expression and compatibility with two-electrode voltage-clamp techniques . For mammalian expression, HEK293 or CHO cells are commonly employed when studying trafficking or complex interactions with other cellular components.

When selecting an expression system, researchers should consider:

  • The specific experimental goals (functional vs. structural studies)

  • Required post-translational modifications

  • Compatibility with downstream assays

  • Expression efficiency and potential toxicity

  • Need for co-expression with auxiliary proteins or subunits

The expression system should be validated through pilot studies comparing protein expression levels and functional responses to ensure reproducibility before proceeding with comprehensive characterization.

What controls are essential when characterizing recombinant srd-3 function?

Rigorous controls are essential for accurate interpretation of functional data. When characterizing recombinant srd-3, researchers should implement:

  • Non-transfected cell controls to account for endogenous responses

  • Empty vector controls to identify vector-related effects

  • Positive controls using well-characterized receptors to validate assay function

  • Species variants as comparative controls (e.g., human vs. rat homologs) to identify species-specific effects

  • Concentration-response curves rather than single concentrations to determine potency and efficacy

  • Time-matched controls to account for receptor desensitization or internalization

These controls enable researchers to distinguish specific srd-3-mediated effects from non-specific or artifact-related observations. For instance, in studies of GABA receptors, comparing wild-type human and rat receptor variants revealed significant differences in agonist sensitivity that would have been overlooked without proper controls .

How can researchers accurately quantify srd-3 expression levels?

Accurate quantification of receptor expression is crucial for normalizing functional data and ensuring reproducibility. Multiple complementary approaches should be employed:

  • Western blotting with validated antibodies (if available) for total protein quantification

  • Surface biotinylation to specifically quantify membrane-expressed receptors

  • Fluorescence microscopy with tagged constructs to visualize localization

  • Radioligand binding assays to quantify functional binding sites

  • qRT-PCR to measure mRNA expression levels

When comparing between experimental conditions, researchers should normalize functional responses to expression levels to account for variation in transfection efficiency. This approach enables more accurate comparison between wild-type and mutant constructs or between different experimental conditions.

How should researchers approach structure-function studies for srd-3?

Structure-function studies require systematic mutation strategies and comprehensive functional characterization. Based on approaches used for similar receptors, researchers should consider:

  • Alanine scanning of key domains to identify functionally important residues

  • Conservative and non-conservative mutations to probe specific amino acid properties

  • Chimeric constructs between species variants to identify domains responsible for functional differences

  • Deletion constructs to examine the role of specific protein domains

  • Introduction of reporter tags (ensuring they don't interfere with function)

When human and rat homologs show functional differences, as observed with certain GABA receptor subunits, systematic substitution of domains between species can identify critical regions responsible for these differences . For example, when investigating GABA receptors, researchers found that "substituting the H alpha(4) subunit with R alpha(4) conferred a significant increase in activation on the GABA and pentobarbital site in terms of reduced EC(50) and increased I(max)" .

What electrophysiological approaches are most appropriate for functional characterization of srd-3?

Electrophysiological characterization provides direct measurement of receptor function and should be designed based on the specific properties of the receptor:

  • Two-electrode voltage clamp in Xenopus oocytes for initial characterization and high-throughput screening

  • Whole-cell patch clamp for detailed kinetic analysis in mammalian cells

  • Single-channel recording for analysis of conductance and open probability

  • Voltage-step protocols to examine voltage dependence

  • Repeated application protocols to examine desensitization and internalization

Specific experimental parameters should be optimized, including:

  • Holding potential (typically -60 to -80 mV for initial screening)

  • Solution composition (ionic strength, pH, temperature)

  • Application duration and frequency

  • Recording duration to capture both fast and slow kinetics

As demonstrated in GABA receptor studies, these approaches can reveal critical functional differences between receptor variants that may have important physiological implications .

How can apparent contradictions in functional data from different assay systems be resolved?

Contradictory results across different assay systems are common in receptor research and require systematic investigation:

  • Directly compare expression levels across systems to identify potential confounds

  • Examine differences in post-translational modifications between expression systems

  • Assess the presence of endogenous interacting proteins that may influence function

  • Compare the sensitivity and dynamic range of different assay readouts

  • Evaluate the impact of recording conditions (temperature, ionic environment)

The approach to reconciling contradictory results is illustrated in studies of recombinant GABA receptors, where different functional properties were observed between human and rat homologs . In such cases, systematic comparison and hypothesis-driven experiments can reveal the molecular basis for these discrepancies.

FactorApproach to InvestigationExample from Literature
Species differencesCompare same receptor from different speciesHuman α4β3δ showed smaller GABA-activated currents than rat α4β3δ
Expression systemTest same construct in different cell typesXenopus oocytes vs. mammalian cell lines
Assay conditionsSystematic variation of key parametersTemperature, ionic conditions, pH
Subunit compositionCombinatorial testing of subunit variantsα4β3δ vs. α4β3γ2S showed different agonist sensitivity
Post-translational modificationMutation of key sitesPhosphorylation, glycosylation sites

What statistical approaches are most appropriate for analyzing concentration-response data for srd-3?

Robust statistical analysis is essential for accurate interpretation of concentration-response data:

  • Use nonlinear regression to fit concentration-response curves and determine EC50/IC50 values

  • Compare curve parameters (EC50, Hill coefficient, maximum response) rather than individual data points

  • Apply appropriate statistical tests based on experimental design:

    • Paired t-tests for within-subject comparisons

    • ANOVA with post-hoc tests for multiple comparisons

    • Model-based approaches for more complex designs

Researchers should avoid common pitfalls such as:

  • Forcing Hill coefficients to 1.0 without justification

  • Comparing EC50 values without considering differences in efficacy

  • Inappropriate pooling of data across independent experiments

  • Using parametric tests when data do not meet normality assumptions

As illustrated in clinical research, model-based statistical approaches often provide more robust analysis than algorithm-based methods when handling complex datasets with multiple variables .

How should researchers approach the analysis of species differences in srd-3 function?

Species differences in receptor function are common and require careful analysis:

  • Compare full concentration-response relationships rather than single-point measurements

  • Analyze multiple functional parameters (potency, efficacy, kinetics)

  • Use chimeric constructs to map regions responsible for species differences

  • Consider the physiological context of each species when interpreting differences

  • Examine co-expression with species-matched auxiliary proteins

Studies of GABA receptors demonstrated significant functional differences between human and rat homologs, with rat α4β3δ showing higher sensitivity to agonists than human α4β3δ . These differences underscore the importance of specifying the species source when reporting receptor characteristics and caution against directly extrapolating findings across species.

A systematic approach to analyzing species differences might include:

ParameterHuman srd-3Rat srd-3Statistical SignificancePotential Functional Implication
EC50 for agonist XX μMY μMp < 0.05Differential sensitivity to endogenous ligands
Maximum responseX%Y%p < 0.05Different efficacy in signaling pathways
Desensitization rateX s-1Y s-1p < 0.05Different temporal signaling patterns
Voltage dependencePresent/AbsentPresent/Absent--Different regulation by membrane potential

What approaches should be used to identify structure-function relationships in mutational studies?

Systematic analysis of mutational data requires:

  • Comparison of multiple functional parameters for each mutation

  • Classification of mutations based on effect type (loss-of-function, gain-of-function, altered specificity)

  • Mapping of functional effects onto structural models/predictions

  • Correlation analysis between amino acid properties and functional parameters

  • Consideration of allosteric effects that may propagate through the protein structure

For example, when investigating GABA receptors, researchers identified that "the presence of the R alpha(4) subunit at recombinant GABA(A) receptors containing the delta-subunit is a strong determinant of agonist action" . Such findings illustrate how systematic mutational analysis can reveal key functional determinants.

How can researchers address low expression levels of recombinant srd-3?

Low expression is a common challenge when working with recombinant receptors. Methodological approaches include:

  • Optimization of expression vectors (promoter strength, Kozak sequence)

  • Codon optimization for the expression system

  • Use of molecular chaperones to improve folding

  • Temperature adjustment during expression (often lower temperatures improve folding)

  • Addition of receptor trafficking enhancers

  • Co-expression with auxiliary proteins that may enhance surface expression

When working with challenging constructs like GABA receptor subunits, researchers have found that "substituting the H alpha(4) subunit with R alpha(4) conferred a significant increase in activation," suggesting that species variants may offer solutions to expression challenges .

What strategies are available for resolving conflicting pharmacological profiles?

Contradictory pharmacological profiles may emerge from different studies. Resolution strategies include:

  • Systematic comparison of experimental conditions:

    • Expression system differences

    • Assay methodology variations

    • Solution composition differences

    • Differences in data analysis approaches

  • Direct head-to-head comparisons under identical conditions

  • Independent verification in multiple systems

  • Consideration of allosteric modulators that may influence agonist sensitivity

  • Evaluation of receptor heterogeneity or alternative splicing

For instance, studies of GABA receptors revealed that "contrary to earlier findings that the alpha(4)beta(3)delta combination was more sensitive to agonist action than the alpha(4)beta(3)gamma(2S) receptor, we observed extremely small GABA- and pentobarbital-activated currents at the wild-type H alpha(4)beta(3)delta receptor" . Such contradictions highlight the importance of comprehensive characterization and careful consideration of experimental conditions.

How should researchers design experiments to distinguish between direct and indirect effects on srd-3 function?

Distinguishing direct receptor modulation from indirect effects requires:

  • Multiple experimental approaches:

    • Purified/reconstituted systems to isolate direct effects

    • Cell-based assays to identify cellular modulatory mechanisms

    • In vitro vs. in vivo comparisons to evaluate physiological context

  • Timecourse studies to separate immediate (likely direct) from delayed (likely indirect) effects

  • Mechanistic studies using pathway inhibitors or genetic knockdown approaches

  • Binding studies to identify direct interactions

  • Mutagenesis of putative interaction sites to confirm direct effects

For receptor studies like those conducted with GABA receptors, these approaches have been crucial for distinguishing direct pharmacological effects from indirect modulatory mechanisms .

What computational approaches can enhance srd-3 structure-function studies?

Computational methods offer powerful complements to experimental approaches:

  • Homology modeling based on related receptors with known structures

  • Molecular dynamics simulations to examine:

    • Ligand binding processes

    • Conformational changes during activation

    • Influence of membrane environment

    • Effects of mutations on protein dynamics

  • Quantitative structure-activity relationship (QSAR) analysis for ligand optimization

  • Virtual screening to identify novel modulators

  • Network analysis to predict functional coupling with other signaling pathways

These computational approaches can generate testable hypotheses and provide mechanistic insights that may not be directly observable through experimental methods alone.

How can researchers effectively integrate electrophysiological and biochemical data for comprehensive characterization?

Comprehensive receptor characterization requires integration of multiple data types:

  • Correlate electrophysiological responses with:

    • Surface expression levels

    • Phosphorylation states

    • Protein-protein interactions

    • Subcellular localization

  • Design experimental workflows that allow sequential analysis of the same samples

  • Develop mathematical models that incorporate both types of data

  • Use consistent experimental conditions across methodologies

  • Apply time-resolved approaches to track dynamic processes

In studies of GABA receptors, this integrative approach revealed that functional differences between subunits were not merely due to expression differences but reflected intrinsic pharmacological properties .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.