Recombinant Serpentine receptor class delta-44 (srd-44)

Shipped with Ice Packs
In Stock

Description

Biological Context

srd-44 is part of the serpentine receptor class delta family, which are transmembrane proteins involved in ligand-binding and cellular communication . While its exact biological role in C. elegans remains understudied, GPCRs like srd-44 are implicated in:

  • Germline Development: RNA-seq data associate srd-44 with germline-neutral, oogenic, and spermatogenic gene clusters .

  • Signal Transduction: GPCRs modulate pathways via G proteins and arrestins, influencing processes from neurotransmission to apoptosis .

Functional Studies

  • Structural Analysis: Recombinant srd-44 enables structural studies to map ligand-binding pockets and signaling interfaces .

  • Gene Expression Profiling: WormCat analysis links srd-44 to germline-specific mRNA functions and transcriptional regulation .

Disease Models

GPCRs are therapeutic targets in neurodegenerative and psychiatric disorders . While srd-44’s direct role is unconfirmed, its homology to human GPCRs suggests potential for:

  • Drug Development: High-throughput screening for ligands or antagonists .

  • Vaccine Research: Utilized as an antigen in C. elegans-based vaccine studies .

Key Challenges and Gaps

  • Functional Data: Limited studies on srd-44’s endogenous ligands or in vivo pathways .

  • Structural Insights: No resolved 3D structures or binding assays available .

References and Citations

This synthesis integrates data from commercial providers , genomic databases , and GPCR research . For experimental use, vendors recommend validating lot-specific activity due to variability in recombinant protein performance .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary based on the purchase method and location. Please contact your local distributor for specific delivery information.
Note: All protein shipments are sent with standard blue ice packs. If dry ice shipping is preferred, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during the production process. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
srd-44; F17A2.8; Serpentine receptor class delta-44; Protein srd-44
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
srd-44
Target Protein Sequence
MFRKILSVLNPTVFVLSLCFQIILIYTIIRHSPKNLSTLKAILLTNCCFQLLQSSMVFFT QIQLVNHLVPIELWSYGPCRHFEAFMCYSMFHILQTSSLVSGLTVFLTTFMKYQAARHVR PSKKKNCFVILFISSIVLISAGCGILLVIIQALPLEIREKYYRINLELDEYSVIGIVDYS VLPSRVNGIIINGLVVIVPITCLLLRRKILKLLTASSDALYFQNRVFLQGLTLQIFGHTL VYVPIFICSTISLITKTEYTFAQFFIFVLPHLTTVIDPLLTMYFVTPYRKRLMVWLRLKN DKVHSVSPSTFAVSANH
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_F17A2.8

UniGene: Cel.26465

Protein Families
Nematode receptor-like protein srd family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of SRD-44 and how does it compare to other serpentine receptors?

SRD-44 belongs to the serpentine receptor class delta family, which are G protein-coupled receptors (GPCRs). Like other GPCRs in the family, SRD-44 likely features a seven-transmembrane domain structure with an extracellular N-terminus and intracellular C-terminus. This structure is consistent with the typical GPCR architecture found in related receptors such as SRD-1, which has been confirmed to harbor seven transmembrane helices in C. elegans .

Comparative structural analysis suggests that the C-terminal region may contain significant sequence variations that could contribute to functional differences. This is supported by findings in SRD-1, where "the most distinct interspecies difference was within the CT region" across Caenorhabditis species .

How is SRD-44 expression regulated in different tissues and model organisms?

While specific SRD-44 expression patterns are still being characterized, insights from related receptors indicate potential sexual dimorphism in expression. For example, SRD-1 "displays a sexually dimorphic expression profile in C. elegans, being highly expressed in ASI, ADF, and AWA neurons in males and only expressed in ASI neurons in hermaphrodites" .

Transcription factors like UNC-3, which belongs to the Olf-1/EBF-family and regulates ASI-specific gene expression in C. elegans, may play similar roles in controlling SRD-44 expression . Researchers should consider examining tissue-specific and sex-specific expression patterns when designing experiments with SRD-44.

What signaling pathways are activated downstream of SRD-44?

Based on the signaling mechanisms of related GPCRs, SRD-44 likely couples to specific G-protein subtypes that trigger distinct intracellular signaling cascades. Similar receptors such as FFA2 interact with both Gi/o and Gq/11-family G proteins, leading to multiple downstream effects including "inhibition of forskolin-stimulated cAMP levels, elevation of intracellular [Ca2+], phosphorylation of ERK1/2, and global cellular changes" .

For comprehensive characterization of SRD-44 signaling, researchers should employ multiple complementary assays rather than relying on a single readout.

What expression systems are optimal for producing functional recombinant SRD-44?

When selecting an expression system for SRD-44, researchers must consider several factors that influence proper folding and trafficking of GPCRs to the cell membrane. As seen with other GPCRs, mutations can lead to "defects in receptor folding and intracellular trapping" .

Various expression systems should be evaluated, including:

  • Mammalian cell lines (HEK293, CHO)

  • Insect cell systems (Sf9, High Five)

  • Yeast expression systems (P. pastoris, S. cerevisiae)

Each system offers different post-translational modification capabilities and membrane compositions that may affect SRD-44 functionality. Co-expression with molecular chaperones may improve yields of properly folded receptor, as molecular chaperones are known to interact with GPCRs during processing .

What strategies can overcome folding and trafficking challenges with recombinant SRD-44?

Several approaches can address common GPCR folding and trafficking challenges:

  • Molecular chaperone co-expression: Consider co-expressing SRD-44 with chaperones shown to assist other GPCRs, such as calnexin, PDI, BiP/Grp78, or Grp94 .

  • Modification of retention motifs: The presence of retention motifs can limit ER exit and cell surface expression. For many GPCRs, modifying these motifs improves trafficking. Examples include the RSRR sequence in GABA-B1 receptors and the 5R (penta-arginine) sequence in α2CAR .

  • Stabilizing disulfide bonds: GPCRs in the rhodopsin/β-adrenergic-like family contain a critical disulfide bond between extracellular loops 1 and 2. Ensuring proper formation of this bond is essential for stabilizing the transmembrane domain structure .

  • Temperature manipulation: Culturing transfected cells at reduced temperatures (e.g., 30°C instead of 37°C) can sometimes improve folding efficiency for challenging GPCRs.

What are the most sensitive methods for detecting SRD-44 function in recombinant systems?

Based on approaches used with other GPCRs, multiple complementary assays should be employed:

Assay TypeParameter MeasuredAdvantagesLimitations
cAMP AssaysChanges in intracellular cAMPHigh sensitivity, well-establishedOnly detects Gs or Gi coupling
Calcium MobilizationIntracellular [Ca2+] elevationReal-time kinetics, compatible with high-throughputLimited to Gq-mediated responses
ERK1/2 PhosphorylationMAPK pathway activationDetects multiple G-protein pathwaysIndirect measurement, potential for off-target effects
Dynamic Mass RedistributionGlobal cellular responsesLabel-free, captures integrated responseLess specific about pathway details
Bioluminescence Resonance Energy Transfer (BRET)Protein-protein interactionsDirect measurement of receptor-effector couplingRequires genetic modification

For SRD-44, researchers should initially employ multiple assays to comprehensively characterize signaling properties before focusing on the most relevant readouts for specific research questions .

How do interspecies variations in SRD-44 sequence affect receptor function?

Interspecies variations in serpentine receptors can significantly impact function. In the case of SRD-1, the protein-coding sequence from C. remanei confers "comparatively stronger pheromone perception ability" than the C. elegans ortholog when expressed in C. elegans neurons .

For SRD-44, researchers should focus on:

  • Comparative sequence analysis across species, particularly examining the C-terminal region

  • Chimeric receptor studies swapping domains between species variants

  • Site-directed mutagenesis of divergent residues

  • Functional analysis in heterologous expression systems

These approaches can reveal evolutionary adaptations and structure-function relationships in SRD-44 across species. Notably, the search results indicate that higher expression levels do not necessarily correlate with increased function, as shown for SRD-1 where "higher expression levels of srd-1 in C. elegans did not correlate with stronger pheromone perception ability" .

What role do post-translational modifications play in SRD-44 function and trafficking?

Post-translational modifications (PTMs) likely play critical roles in SRD-44 function, similar to other GPCRs. Research should focus on:

  • N-linked glycosylation sites in the extracellular domain, which can affect receptor folding and cell surface expression

  • Palmitoylation of cysteine residues in the C-terminal domain, which can influence receptor stability and signaling

  • Phosphorylation sites that may regulate desensitization and internalization

Experimental approaches should include:

  • Site-directed mutagenesis of potential PTM sites

  • Mass spectrometry analysis of purified receptor

  • Comparison of receptor properties in expression systems with different PTM capabilities

How can targeted mutagenesis create SRD-44 variants with altered ligand specificity?

Creating receptor variants with altered ligand specificity is valuable for understanding structure-function relationships and developing experimental tools. Research on related receptors provides useful strategies:

The FFA2 receptor was engineered to respond to non-endogenous ligands through strategic mutations. For example, "replacement of lysine at position 65 with alanine plus a second mutation in human FFA2 resulted in a substantial gain in potency for sorbic acid," creating a receptor that responded to the non-endogenous ligand while maintaining response to endogenous ligands .

To eliminate endogenous ligand responses, additional mutations were necessary: "alteration of His242 to glutamine achieved this, resulting in a form of the receptor that still displayed strong responsiveness to sorbic acid but now with virtually no response to any endogenous SCFA" .

For SRD-44, researchers could:

  • Identify key ligand-binding residues through homology modeling and docking simulations

  • Create point mutations at these positions

  • Screen mutants for altered ligand responses

  • Combine mutations to achieve desired specificity profiles

Such engineered receptors can serve as valuable tools for in vivo studies, allowing selective activation of SRD-44 signaling pathways.

How should researchers address contradictory findings in SRD-44 studies across different model systems?

When confronted with contradictory findings across different model systems, researchers should:

  • Evaluate expression system differences: Different cell types may provide varying cellular environments that affect receptor function. For example, molecular chaperones critical for proper GPCR folding may be differentially expressed across systems .

  • Consider species-specific variations: As demonstrated with SRD-1, significant functional differences can exist between orthologs despite sequence similarity. The C-terminal region appears particularly important for determining receptor properties in serpentine receptors .

  • Examine experimental methodology variations: Different assay systems may produce varying results. For instance, some compounds active in one assay may show no activity in others, as seen with compound "39" which "was active at both human and mouse FFA2," while compound "40" "appeared to act as a potent agonist only at the human ortholog" .

  • Analyze post-translational modifications: Differential glycosylation or phosphorylation patterns across expression systems can significantly impact receptor function.

  • Perform parallel experiments: Using standardized protocols across multiple systems can help isolate variables contributing to contradictory findings.

What considerations are critical when interpreting SRD-44 polymorphism data?

When analyzing SRD-44 polymorphism data, researchers should consider:

  • Functional impact assessment: Not all polymorphisms affect function. In the dopamine D4 receptor, a variable number of tandem repeats (VNTR) creates variants with 2-11 repeats of a 48-bp sequence . For SRD-44, similar polymorphisms might exist.

  • Species conservation analysis: Polymorphisms conserved across species (like the D4 receptor VNTR found in non-human primates but absent in rodents ) may indicate functional importance.

  • Tissue-specific effects: Polymorphic variants may show tissue-specific functional differences that could be missed in single-system studies.

  • Population distribution: Frequency distribution of polymorphisms across populations can provide insights into evolutionary selection pressures.

  • Structure-function relationship: Mapping polymorphisms onto structural models can help predict potential functional effects.

Key Molecular Chaperones for GPCR Folding and Trafficking

ChaperoneFunctionAssociated GPCRsPotential Application to SRD-44
CalnexinER quality controlLHCGR variantsMay assist proper folding of SRD-44
PDIProtein disulfide isomeraseWild-type LHCGRCritical for proper disulfide bond formation
BiP/Grp78ER chaperoneLHCGR variantsGeneral folding assistance
Grp94ER chaperoneAla593Pro LHCGR mutantMay interact with specific SRD-44 conformations
Golgin-160Promotes upward traffickingβ1ARCould enhance surface expression
RAMPsPromote translocation, regulate signalingMultiple GPCRsMay modulate SRD-44 trafficking and function
ODR4Facilitates folding, ER exit, and PM targetingOlfactory GPCRs (e.g., ODR10)Particularly relevant for SRD receptors in C. elegans

Critical Motifs and Structural Features for GPCR Trafficking

Motif/FeatureLocationFunctionPotential Application to SRD-44
6LL motifProximal N-terminal end of C-tailControls upward traffickingMay regulate SRD-44 surface expression
F(x)3F(x)3FOverlaps with 6LL motifInteracts with DRiP78; mutation causes retentionConserved hydrophobic motifs may be present in SRD-44
RSRR sequenceVariableER retention signalMay regulate SRD-44 export from ER
Disulfide bondBetween EL1 and EL2Stabilizes TMD structureCritical for proper SRD-44 folding

Comparison of Serpentine Receptor Expression Patterns

SpeciesReceptorExpression PatternRelevance to SRD-44 Research
C. elegans (males)SRD-1ASI, ADF, and AWA neuronsSRD-44 may show similar sexually dimorphic expression
C. elegans (hermaphrodites)SRD-1ASI neurons onlySex-specific expression should be investigated for SRD-44
C. remanei (males)SRD-1Higher expression than C. elegans malesInterspecies variation in expression levels may occur

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.