Recombinant Serpentine receptor class delta-50 (srd-50)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Serpentine Receptor Class Delta-50 (srd-50)

Recombinant Serpentine receptor class delta-50 (srd-50) is a transmembrane protein derived from Caenorhabditis elegans, classified within the serpentine receptor family. These receptors are characterized by seven transmembrane (7-TM) helices, a structural feature shared with G-protein-coupled receptors (GPCRs) and other heptahelical proteins . The srd-50 protein is produced via recombinant DNA technology, enabling its use in biochemical studies, structural analyses, and functional assays .

Expression Systems

Two primary production methods are documented:

  1. Full-Length Production:

    • Host: E. coli or mammalian cells .

    • Purity: ≥85% via SDS-PAGE .

    • Tag: N-terminal His-tag for affinity chromatography .

  2. Partial Production:

    • Host: Yeast, baculovirus, or other systems .

    • Purity: ≥85% (SDS-PAGE) .

Comparative Analysis of Recombinant Variants

ParameterFull-Length (CSB-CF622157CXY) Partial (MyBioSource)
HostE. coliCell-free or partial systems
Protein Length1–337 AA (full-length)Partial (exact region unspecified)
TaggingN-terminal 10xHis-tagUntagged
Purity≥85%≥85%
Shelf Life6 months (liquid), 12 months (lyophilized)Not specified

Research Applications

While direct functional studies on srd-50 remain limited, its recombinant form is utilized in:

  • ELISA Assays: For detecting binding interactions or antibody validation .

  • Structural Studies: To investigate 7-TM domain dynamics and ligand recognition .

  • Drug Discovery: As a template for designing small-molecule modulators targeting serpentine receptors .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
srd-50; F15A2.4; Serpentine receptor class delta-50; Protein srd-50
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-337
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
srd-50
Target Protein Sequence
MMSAMETNMVLILTIFYNAYFLLAISSQLLLLYLMLKCQNRSLHEMRIYLFNILGLQFIS TFSAFVLQCRLKRVTLKHFCRIVPSSGTVAMLCYGPCKYLGNIVCEVLFHILQTSLNACA TALIIAFYYRYEMLTNNSFTRSGHYKQLVISYCVPLVFLICEVLSPNDVNKLVAELTVLH PTYGLENYAILGFSDVKTVAASSQTLMLMIGLYGTPFIALVFRKKIIKILHSSRSYHAEK IVQTKSMIQGLTLQTLLPLICYCPGFTYYIYSQYTQSSSLFVEFAVSPYGFVYTIFDPLL TIYYVLPYRRTFKAIFSKHNSTTSATFVHSETARRVA
Uniprot No.

Target Background

Database Links
Protein Families
Nematode receptor-like protein srd family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Serpentine receptor class delta-50 (srd-50)?

Serpentine receptor class delta-50 (srd-50) is a membrane protein belonging to the G protein-coupled receptor (GPCR) superfamily, specifically found in Caenorhabditis elegans. The full-length protein consists of 337 amino acids and is encoded by the srd-50 gene (also known by its ORF name F15A2.4). The protein has a UniProt identification number of Q19474 and functions as a chemosensory receptor involved in signal transduction pathways in C. elegans . The protein contains multiple transmembrane domains characteristic of serpentine receptors, with specific regions responsible for ligand binding and signal transduction across the cell membrane.

What expression systems are available for producing recombinant srd-50?

Recombinant srd-50 can be produced using multiple expression systems depending on research requirements:

Expression SystemFeaturesTypical PurityApplication
Cell-Free ExpressionRapid production, avoids cellular toxicity≥85%Structural studies, protein-protein interactions
E. coliHigh yield, cost-effective, His-tagged options≥85%Functional assays, antibody production
YeastPost-translational modifications≥85%Functional studies requiring glycosylation
BaculovirusInsect cell expression, complex modifications≥85%Structural biology, functional assays
Mammalian CellMost native-like modifications≥85%Signaling studies, therapeutic applications

The expression system selection should be based on experimental needs, with purity generally determined by SDS-PAGE analysis . For studies requiring native-like protein folding and post-translational modifications, mammalian or insect cell expression systems are preferable, while high-yield applications may benefit from bacterial expression.

How should recombinant srd-50 be stored to maintain activity?

Optimal storage conditions for recombinant srd-50 include maintaining the protein at -20°C for regular use, or -80°C for extended storage periods. The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized to maintain protein stability and prevent degradation . For working experiments, it is recommended to prepare small aliquots stored at 4°C for up to one week to minimize freeze-thaw cycles. Repeated freezing and thawing should be avoided as this can lead to protein denaturation and loss of activity . When designing experiments, researchers should incorporate appropriate controls to verify protein activity after storage, particularly for functional assays where receptor conformation is critical.

How should experiments be designed to study srd-50 function in vitro?

When designing experiments to study srd-50 function in vitro, researchers should follow systematic approaches that enable reliable data collection and analysis. The experimental design should include:

  • Proper controls: Include positive controls (known ligands for related receptors), negative controls (buffer only), and specificity controls (related but distinct receptors).

  • Randomization: Implement randomization in sample processing and measurement to minimize bias in the experimental setup .

  • Replication strategy: Determine the appropriate number of technical and biological replicates based on statistical power analysis to ensure reliable detection of effects.

  • Response variables: Select appropriate readouts such as ligand binding assays, G-protein activation measurements, or downstream signaling markers.

  • Statistical analysis plan: Develop the analysis approach before conducting experiments, considering the data structure and experimental factors .

For functional characterization, binding assays using labeled ligands or reporter-based signaling assays are common approaches. When studying membrane proteins like srd-50, consideration should be given to maintaining the native membrane environment, potentially through reconstitution in lipid bilayers or nanodiscs.

What are the key considerations for designing experiments investigating srd-50 in Caenorhabditis elegans models?

When designing in vivo experiments with C. elegans to study srd-50 function, researchers should consider:

  • Genetic manipulation approaches:

    • CRISPR/Cas9 gene editing for precise mutations

    • RNAi knockdown for tissue-specific and temporal control of srd-50 expression

    • Transgenic overexpression with tissue-specific promoters

  • Experimental blocking: Organize experimental units into blocks to control for environmental variables that may affect C. elegans behavior or physiology .

  • Split-plot design: Consider hierarchical experimental structures where some factors apply to whole groups of worms while others apply to individuals .

  • Behavioral assays: Design appropriate chemotaxis, avoidance, or preference assays that can detect sensory functions potentially mediated by srd-50.

  • Molecular readouts: Include molecular phenotyping such as gene expression analysis to identify downstream targets of srd-50 signaling.

The experimental design should be constructed to isolate the specific effects of srd-50 from other potentially confounding variables, with attention to appropriate control strains and standardized culture conditions to minimize variability.

How can mixture experiments be applied to optimize buffer conditions for recombinant srd-50?

Mixture experiments represent an effective approach for optimizing buffer conditions for recombinant srd-50 stability and activity. In mixture experiments, the proportions of components sum to a constant (typically 1 or 100%), making them ideal for buffer optimization where the relative concentrations of components are critical .

To implement a mixture experiment for srd-50 buffer optimization:

  • Identify key components: Select buffer components that may affect protein stability (e.g., salts, stabilizers, pH buffers, glycerol).

  • Define constraints: Establish upper and lower bounds for each component based on biochemical principles.

  • Select design: Use specialized mixture designs such as simplex-lattice or simplex-centroid designs appropriate for constrained mixtures .

  • Implement randomization: Randomize the experimental run order to minimize systematic errors.

  • Analyze models: Fit appropriate mixture models, such as Scheffé polynomials, to identify optimal component proportions .

For example, a mixture experiment might investigate the optimal proportions of Tris buffer, NaCl, glycerol, and stabilizing agents to maximize srd-50 stability. Response surface methodologies can be particularly valuable when process variables (like temperature or pH) need to be optimized simultaneously with mixture components .

What strategies can resolve contradictions in experimental data when studying srd-50 signaling pathways?

When faced with contradictory results in srd-50 signaling studies, researchers should implement a systematic approach to resolve these discrepancies:

For example, if contradictory results emerge regarding srd-50 ligand specificity between in vitro binding assays and in vivo behavioral tests, systematic investigation of potential contextual factors (like receptor conformation differences in different environments) may resolve the apparent contradiction.

How can robust parameter design be applied to optimize recombinant srd-50 production?

Robust parameter design (RPD) provides a framework for optimizing recombinant srd-50 production processes to be insensitive to uncontrollable variations. This approach is particularly valuable for ensuring consistent protein quality across different production batches .

Implementation of RPD for srd-50 production involves:

  • Identifying control factors: These are parameters researchers can adjust, such as:

    • Induction timing and concentration

    • Growth media composition

    • Expression temperature

    • Harvest time

  • Identifying noise factors: These are sources of variation that cannot be controlled in routine production:

    • Batch-to-batch reagent variability

    • Environmental fluctuations

    • Biological variability in expression systems

  • Experimental design: Create a crossed array design where control factors and noise factors are systematically varied .

  • Analysis approach:

    • Calculate mean response and signal-to-noise ratios

    • Identify control factor settings that maximize the mean and minimize variance

    • Use response surface methodology to model the relationship between factors and responses

  • Confirmation runs: Validate the optimized parameters with confirmation experiments.

This approach has been successfully applied in biopharmaceutical manufacturing to identify production conditions that deliver consistent protein quality despite uncontrollable variations in raw materials or environmental conditions .

What are the methodological approaches for investigating potential srd-50 interactions with other signaling proteins?

Investigating protein-protein interactions (PPIs) involving srd-50 requires a multi-faceted approach combining in vitro, in vivo, and computational methods:

  • In vitro interaction studies:

    • Co-immunoprecipitation using tagged recombinant srd-50

    • Surface plasmon resonance (SPR) for binding kinetics

    • Proximity-based labeling methods (BioID, APEX)

    • Fluorescence resonance energy transfer (FRET) for direct interaction detection

  • Genetic interaction mapping:

    • Synthetic genetic arrays in C. elegans

    • Suppressor and enhancer screens

    • Double mutant phenotypic analysis

  • Computational prediction and validation:

    • Structural modeling based on the srd-50 amino acid sequence

    • Molecular docking simulations

    • Network analysis using existing interactome data

  • Functional validation:

    • Signaling pathway reconstitution in heterologous systems

    • Mutational analysis of interaction interfaces

    • Competition assays with predicted binding partners

When designing these experiments, careful consideration should be given to the membrane-bound nature of srd-50, which may require specialized techniques to maintain protein conformation and accessibility. Additionally, interaction studies should be conducted using multiple complementary methods to increase confidence in the results and avoid technique-specific artifacts.

How should researchers analyze and interpret contradictory results in srd-50 localization studies?

Contradictory results in srd-50 localization studies can arise from differences in experimental conditions, detection methods, or biological contexts. When faced with such contradictions, researchers should:

  • Systematically compare methodologies: Create a detailed comparison table of:

    • Fixation and permeabilization protocols

    • Antibody or tag detection systems

    • Imaging modalities and resolution

    • Cell or tissue types examined

  • Apply a 3-way contradiction resolution framework:

    • Classify each result as "YES" (localization confirmed), "NO" (localization contradicted), or "UNKNOWN" (inconclusive)

    • Analyze patterns to identify condition-dependent localization

  • Integrate multiple detection approaches:

    • Combine antibody-based detection with fluorescent protein tagging

    • Complement imaging with subcellular fractionation and biochemical analyses

    • Use super-resolution techniques to resolve ambiguous localizations

  • Consider dynamic localization: Investigate whether contradictions reflect:

    • Developmental or cell-cycle dependent changes

    • Stimulus-induced translocation

    • Cell type-specific differences in localization

  • Validate with functional assays: Connect localization findings with functional readouts to determine the biological relevance of different localizations.

This structured approach allows researchers to determine whether contradictions represent technical artifacts or biologically meaningful variations in srd-50 localization under different conditions.

What statistical approaches are most appropriate for analyzing dose-response relationships in srd-50 activation studies?

When analyzing dose-response relationships in srd-50 activation studies, researchers should select statistical approaches that account for the non-linear nature of receptor activation and potential variability between experimental runs:

  • Non-linear regression models:

    • Four-parameter logistic regression for complete sigmoid curves

    • Three-parameter models when maximum effect is constrained

    • Biphasic models for complex response patterns

  • Statistical inference considerations:

    • Confidence intervals for EC50/IC50 values

    • Comparison of curve parameters across conditions

    • Tests for parallelism when comparing multiple compounds

  • Experimental design considerations:

    • Determination of appropriate sample size through power analysis

    • Within-plate controls to normalize for plate-to-plate variation

    • Randomized or balanced block designs to control for positional effects

  • Handling variability:

    • Mixed-effects models to account for batch effects

    • Weighted regression when variance is heterogeneous

    • Robust regression methods for outlier resistance

  • Model validation:

    • Residual analysis to verify model assumptions

    • Cross-validation to assess predictive performance

    • Comparison of alternative models using information criteria

These approaches allow researchers to extract meaningful biological parameters from dose-response data while appropriately accounting for experimental variability and the inherent complexity of receptor signaling responses.

What are emerging methodologies for studying structure-function relationships in serpentine receptors like srd-50?

Emerging methodologies for studying structure-function relationships in serpentine receptors like srd-50 include:

  • Cryo-electron microscopy (Cryo-EM):

    • Near-atomic resolution structures of membrane proteins

    • Visualization of different conformational states

    • Reduced protein quantity requirements compared to crystallography

  • Computational approaches:

    • AlphaFold2 and RoseTTAFold for structure prediction

    • Molecular dynamics simulations for conformational changes

    • Machine learning classification of structure-function relationships

  • Single-molecule techniques:

    • FRET-based conformational analysis

    • Force spectroscopy for mechanical properties

    • Single-molecule tracking in native membranes

  • Novel expression systems:

    • Cell-free membrane protein expression with nanodiscs

    • Engineered lipid environments for functional studies

    • Directed evolution for improved expression and stability

  • Integrated multi-omics approaches:

    • Combined proteomics, lipidomics, and functional assays

    • Correlation of post-translational modifications with function

    • System-level analysis of receptor interaction networks

These methodologies can be applied to srd-50 to better understand its ligand binding properties, activation mechanisms, and signaling outputs, potentially leading to new insights into its biological role in C. elegans and the general principles of serpentine receptor function.

How can researchers effectively design experiments to elucidate the physiological role of srd-50 in C. elegans?

To effectively elucidate the physiological role of srd-50 in C. elegans, researchers should design experiments that integrate multiple levels of analysis:

  • Genetic manipulation strategies:

    • Generate precise mutations targeting specific domains

    • Create conditional alleles for temporal control

    • Develop fluorescent reporter fusions for in vivo visualization

  • Behavioral phenotyping:

    • Design high-throughput tracking systems for subtle behavioral effects

    • Create environmental gradients to test chemosensory responses

    • Implement learning and memory paradigms to test integrative functions

  • Circuit-level analysis:

    • Use optogenetic activation/inhibition to manipulate srd-50-expressing neurons

    • Employ calcium imaging to monitor neural activity in vivo

    • Map connectivity of srd-50-expressing cells within neural circuits

  • Molecular phenotyping:

    • Apply RNA-seq to identify transcriptional consequences of srd-50 mutation

    • Use phosphoproteomics to map signaling pathways downstream of srd-50

    • Implement metabolomics to identify physiological outputs

  • Environmental and life-history considerations:

    • Test phenotypes across different life stages

    • Examine responses to various environmental stressors

    • Investigate potential roles in developmental timing or lifespan regulation

The experimental design should incorporate proper controls, randomization, and replication to ensure reliable results . Additionally, researchers should consider using factorial designs to efficiently test interactions between genetic manipulations and environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.