Recombinant Serpentine receptor class delta-55 (srd-55)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Serpentine receptor class T-55 (srt-55) is a transmembrane protein belonging to the G protein-coupled receptor (GPCR) superfamily. It is encoded by the srt-55 gene (ORF T16H12.8) in C. elegans and plays roles in chemosensation and intercellular signaling . Recombinant srt-55 is produced in E. coli for research applications, enabling studies on GPCR structure-function relationships .

Expression and Purification

Recombinant srt-55 is expressed in E. coli and purified via affinity chromatography. Critical parameters include:

ParameterDetail
Expression SystemE. coli (in vitro)
Storage BufferTris-based buffer with 50% glycerol
Purity>90% (SDS-PAGE verified)
Storage Conditions-20°C (short-term); -80°C (long-term)
StabilityAvoid repeated freeze-thaw cycles

Research Applications

  • Ligand-Binding Assays: Used to screen small molecules targeting GPCRs .

  • Structural Studies: Facilitates cryo-EM and X-ray crystallography efforts due to high purity .

  • Functional Genomics: C. elegans mutants lacking srt-55 exhibit defects in chemotaxis and egg-laying behavior, implicating it in neuromodulation .

Comparative Analysis with Other Serpentine Receptors

ReceptorSpeciesLength (aa)TM DomainsUniProt ID
srt-55C. elegans3457P34571
PfSR10Plasmodium falciparum3577N/A
srd-3C. elegans3447O17240

PfSR10 and srd-3 are functional analogs in other organisms but share <30% sequence homology with srt-55 .

Challenges and Limitations

  • Instability: Requires stringent storage conditions to prevent aggregation .

  • Heterogeneity: Post-translational modifications in native tissues may not be replicated in E. coli-expressed protein .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the product for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
srd-55; K02A2.2; Serpentine receptor class delta-55; Protein srd-55
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-334
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
srd-55
Target Protein Sequence
MTSLSSNRIVPFVDIYFKIYFYGGLTFQLLLLTLILTKSPSILTNLKFFLINTCFLQIIL ISLGFFTQHRSLPNIDSFAVLPRGPCREFGPDVCFSAYHFFLGVALCVGLGISNTIIFRF QALRKGRVSRSRIFTMISLTYIPSSITIILPFTSSWDFEKVRSLTYIEHPKYDLSIYEPF VGFHNIASFQFTLATLLLVIGAYAIPAISGFLTSRVIHLINDNRGMSLKTKEQSKTLAYG LACQTFLPVICYIPVASCYIFSQMTSVELLLNEHLLGILICFPSFVDPFISFYFIVPYRQ ALLGLFKCRKTKPLNIVITVRHLSKRNPSIVDSN
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_K02A2.2

STRING: 6239.K02A2.2

UniGene: Cel.28770

Protein Families
Nematode receptor-like protein srd family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Serpentine receptor class delta-55 (srd-55)?

Serpentine receptor class delta-55 (srd-55) is a G-protein coupled receptor protein found in Caenorhabditis elegans. The full-length protein consists of 334 amino acids and functions as a membrane-bound receptor involved in signaling pathways. Like other members of the serpentine receptor family, it features a characteristic seven-transmembrane domain structure that facilitates signal transduction across the cell membrane. The receptor serves as a molecular detector that transduces extracellular signals into intracellular responses, which is critical for various cellular functions and physiological processes in C. elegans. This receptor belongs to a larger family of proteins that play essential roles in chemosensation and other sensory functions in nematodes.

What expression systems are commonly used for recombinant srd-55 production?

Several expression systems have been successfully employed for the production of recombinant srd-55, each with distinct advantages depending on the research application. The most common expression system is Escherichia coli, which offers high yield and cost-effectiveness for basic structural studies. The protein is typically produced with a His-tag to facilitate purification, with the full-length protein (1-334 amino acids) being expressed. For researchers requiring post-translational modifications or enhanced protein folding, expression systems like yeast, baculovirus, or mammalian cell cultures may be preferable, though these typically result in lower yields. When selecting an expression system, researchers should consider the balance between protein yield, proper folding, functional activity, and the presence of required post-translational modifications for their specific experimental needs.

How is the purity and integrity of recombinant srd-55 assessed?

Assessment of recombinant srd-55 purity and integrity involves multiple complementary analytical techniques. The standard quality threshold for research applications is typically ≥85% purity as determined by SDS-PAGE analysis, which separates proteins based on molecular weight to verify the presence of a band corresponding to the expected size of srd-55. For more detailed characterization, researchers should employ Western blotting using anti-His antibodies (for His-tagged variants) or specific anti-srd-55 antibodies to confirm protein identity. Additional techniques include size exclusion chromatography to assess aggregation status, mass spectrometry for precise molecular weight determination and sequence coverage, and circular dichroism to evaluate secondary structure elements. When assessing functional integrity, ligand binding assays or GTPγS binding assays may be used to confirm that the recombinant protein maintains its native activity and proper folding.

What are the methodological approaches for studying srd-55 signaling pathways?

Investigating srd-55 signaling pathways requires a multi-faceted experimental approach. Researchers should begin with in vitro GTPγS binding assays to measure receptor-mediated G-protein activation, followed by downstream second messenger measurements (cAMP, calcium, or IP3) depending on the G-protein coupling preference. For cellular contexts, BRET (bioluminescence resonance energy transfer) or FRET (fluorescence resonance energy transfer) assays provide real-time monitoring of protein interactions within the signaling cascade. When studying srd-55 in C. elegans models, researchers can employ genetic approaches like RNAi knockdown or CRISPR-Cas9 modifications combined with behavioral assays to correlate receptor function with phenotypic outcomes. Pharmacological manipulation using pathway-specific inhibitors helps delineate the precise signaling routes. Phosphoproteomic analysis after receptor activation offers comprehensive mapping of the signaling network. Throughout these studies, appropriate controls including known GPCR pathways should be included to validate experimental systems and contextualize findings specific to srd-55.

How can researchers identify and validate potential ligands for srd-55?

Ligand identification for srd-55 requires systematic screening methodologies combined with validation techniques. The initial screening approach should utilize high-throughput compound libraries tested against cells expressing recombinant srd-55, measuring changes in second messenger levels, calcium flux, or reporter gene activation as indicators of receptor engagement. Computational approaches including homology modeling and molecular docking can predict potential ligands based on the receptor's binding pocket architecture. For validation of hit compounds, researchers should employ direct binding assays using purified recombinant srd-55 with techniques such as surface plasmon resonance (SPR), isothermal titration calorimetry (ITC), or microscale thermophoresis (MST) to determine binding kinetics and affinity constants. Functional validation requires dose-response experiments in cellular systems expressing srd-55, measuring both receptor activation and signaling outcomes. Final confirmation should include testing in C. elegans models to assess behavioral or physiological responses to the candidate ligand, correlating in vitro findings with in vivo relevance.

What are the technical challenges in expressing functional recombinant srd-55?

Expression of functional recombinant srd-55 presents several technical challenges that researchers must address. The hydrophobic nature of the seven transmembrane domains often leads to protein aggregation or misfolding during expression, particularly in bacterial systems. To overcome this, researchers should optimize expression conditions by testing different detergents (e.g., DDM, LMNG, or GDN) and considering the addition of cholesterol or specific lipids to mimic the native membrane environment. Codon optimization for the expression host is essential, as is careful temperature control during induction (typically lower temperatures of 16-18°C slow protein production and improve folding). For enhanced stability, fusion partners such as T4 lysozyme or thermostabilized proteins may be incorporated into flexible loop regions. Expression in insect or mammalian cells can improve proper folding but introduces challenges in scale-up and cost. Post-translational modifications may be crucial for function, necessitating eukaryotic expression systems in some cases. Finally, functional validation through ligand binding or signaling assays is critical to confirm that the expressed protein maintains its native conformation and activity.

What structural characterization techniques are most suitable for analyzing recombinant srd-55?

Structural characterization of recombinant srd-55 requires a strategic combination of techniques to address its membrane protein nature. For high-resolution structural determination, X-ray crystallography remains the gold standard but requires optimization of crystallization conditions using lipidic cubic phase methods, which better accommodate membrane proteins. Cryo-electron microscopy (cryo-EM) offers advantages for GPCRs like srd-55 without the need for crystallization, though protein size may limit resolution. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) provides valuable insights into conformational dynamics and ligand-induced changes in specific regions. Nuclear magnetic resonance (NMR) spectroscopy can elucidate structure-function relationships, particularly for smaller fragments or domains of srd-55. Circular dichroism spectroscopy offers rapid assessment of secondary structure content and thermal stability. For initial screening and optimization, limited proteolysis combined with mass spectrometry helps identify stable domains. Researchers should consider employing nanobodies or stabilizing mutations to facilitate structural studies, as these approaches have proven successful with other challenging GPCRs.

How can researchers assess the interaction of srd-55 with other proteins in signaling complexes?

Assessment of srd-55 protein interactions requires both in vitro and cellular approaches to capture the complete interactome. For direct protein-protein interactions, co-immunoprecipitation with anti-srd-55 or anti-tag antibodies followed by mass spectrometry analysis provides unbiased identification of binding partners. Proximity-based labeling techniques such as BioID or APEX2 fused to srd-55 allow identification of both stable and transient interactors in living cells. For dynamic monitoring of specific interactions, BRET/FRET assays with fluorescently labeled srd-55 and candidate partners enable real-time visualization of complex formation. Pull-down assays using purified recombinant srd-55 as bait can confirm direct interactions with specific proteins of interest. Surface plasmon resonance or biolayer interferometry provides quantitative binding kinetics for purified components. In C. elegans, genetic interaction screens can reveal functional relationships, while split-protein complementation assays visualize interactions in living animals. Systematic analysis should include both basal and ligand-stimulated conditions to capture dynamic changes in the interactome following receptor activation.

What are the optimal buffer and storage conditions for maintaining recombinant srd-55 stability?

Maintaining stability of recombinant srd-55 requires carefully optimized buffer and storage conditions. For purified protein, a standard buffer system containing 20-50 mM Tris-HCl or HEPES at pH 7.4-8.0, supplemented with 100-150 mM NaCl provides initial stability. Critical additives include 5-10% glycerol to prevent freeze-thaw damage, and reducing agents such as 1-5 mM DTT or 0.5-1 mM TCEP to maintain cysteine residues in reduced state. For membrane proteins like srd-55, the inclusion of appropriate detergents is essential—typically 2-3× critical micelle concentration of mild detergents like DDM, LMNG, or GDN. Some researchers add specific lipids (0.01-0.02% cholesterol or phospholipids) to mimic the native membrane environment. Protease inhibitor cocktails prevent degradation during handling. For long-term storage, researchers should divide the protein into single-use aliquots, flash-freeze in liquid nitrogen, and store at -80°C. Repeated freeze-thaw cycles significantly reduce activity, so thawed protein should not be refrozen. Stability can be monitored over time using activity assays, size-exclusion chromatography, or thermal shift assays to determine optimal conditions for specific experimental applications.

How can researchers design experiments to identify the physiological functions of srd-55 in C. elegans?

Designing experiments to elucidate srd-55 physiological functions in C. elegans requires a comprehensive approach combining genetic, behavioral, and molecular techniques. Begin with precise genetic manipulation, using CRISPR-Cas9 to generate knockout, knockdown, or reporter-tagged srd-55 variants. Expression pattern analysis using transcriptional and translational GFP fusions helps identify the tissues where srd-55 functions. For behavioral phenotyping, researchers should employ standardized assays examining chemotaxis, thermotaxis, social feeding, and stress responses, comparing wild-type, mutant, and rescue lines. Cell-specific rescue experiments, where srd-55 is expressed only in specific neurons or tissues in a mutant background, can pinpoint the anatomical focus of function. Calcium imaging using GCaMP in identified neurons expressing srd-55 allows correlation of neural activity with stimuli. For molecular characterization, RNA-seq of srd-55 mutants versus wild-type identifies dysregulated pathways, while ChIP-seq can reveal transcriptional regulatory networks affected by srd-55 signaling. Electrophysiological recordings from neurons expressing srd-55 provide direct functional insights. Throughout these experiments, researchers should include appropriate controls and multiple independent lines to ensure reproducibility.

What strategies can be employed for high-throughput screening of compounds that modulate srd-55 activity?

High-throughput screening for srd-55 modulators requires a systematic approach with robust assay development and validation. Researchers should first establish a stable cell line expressing srd-55 at physiological levels, preferably using inducible expression systems to control receptor density. Primary screening assays should employ functional readouts like calcium mobilization using FLIPR, cAMP accumulation using HTRF technology, or β-arrestin recruitment using enzyme complementation or BRET systems. These cell-based assays can be miniaturized to 384- or 1536-well formats for increased throughput. Screening libraries should include diverse chemical scaffolds, natural products, and focused collections based on structural similarities to known GPCR ligands. Hit confirmation requires dose-response testing and counter-screening in parental cells lacking srd-55 expression to eliminate false positives. Secondary assays should include direct binding measurements, receptor internalization, and pathway-specific reporter systems to classify compounds as agonists, antagonists, or allosteric modulators. Lead compounds can be further validated in C. elegans models expressing wild-type or mutant srd-55 to correlate in vitro activity with in vivo effects. Throughout the screening campaign, control compounds for assay validation and data normalization are essential, even if known srd-55 ligands are unavailable.

How should researchers interpret discrepancies in experimental results when studying recombinant srd-55?

Interpreting discrepancies in srd-55 experimental results requires systematic troubleshooting and critical analysis. First, researchers should examine differences in protein preparation—variations in expression systems (E. coli vs. yeast vs. mammalian cells) can significantly impact post-translational modifications and folding, potentially altering functional properties. The presence and position of affinity tags may interfere with specific functions or interactions, necessitating comparison between differently tagged constructs or tag-free protein. Buffer composition discrepancies, especially in detergent type and concentration, lipid content, or ionic strength, can substantially affect receptor conformation and activity. Assay-specific variables such as temperature, incubation time, and detection method sensitivity thresholds may produce apparently conflicting results across different experimental platforms. For cell-based assays, expression levels, cellular background (which determines the available G-protein subtypes and effector molecules), and passage number can introduce variability. Researchers should systematically isolate these variables by performing controlled experiments with internal standards and positive controls. When discrepancies persist, orthogonal methods addressing the same biological question can help establish consensus findings. Documentation of all experimental conditions in publications is crucial for reproducibility and resolution of apparent contradictions in the field.

What are the current limitations in srd-55 research and how might they be addressed?

Current limitations in srd-55 research span technical, biological, and methodological domains. The primary technical challenge remains the production of sufficient quantities of properly folded, functional receptor for structural and biochemical studies. This might be addressed through novel expression systems, such as cell-free approaches or specialized host strains optimized for membrane protein production. The absence of identified natural ligands significantly hampers functional characterization; addressing this will require comprehensive deorphanization efforts combining in silico prediction, compound library screening, and metabolomics approaches. Limited understanding of tissue-specific functions and signaling pathways in vivo necessitates the development of more sensitive tools for studying srd-55 in its native context, including conditional knockouts, optogenetic regulators, and improved biosensors for downstream effectors. The field is also constrained by the lack of selective pharmacological tools (agonists, antagonists, and allosteric modulators), which could be addressed through focused medicinal chemistry efforts once initial hit compounds are identified. Finally, translating findings from C. elegans to mammalian systems remains challenging, requiring comparative studies with the closest human homologs to establish evolutionary conservation of mechanisms. Collaborative, interdisciplinary approaches combining expertise in structural biology, pharmacology, genetics, and computational modeling will be essential to overcome these limitations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.