Recombinant Serpentine receptor class delta-63 (srd-63)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. We recommend contacting your local distributor for specific delivery estimates.
All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which you may use as a reference.
Shelf Life
Shelf life can be influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
srd-63; F13A7.2; Serpentine receptor class delta-63; Protein srd-63
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-321
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
srd-63
Target Protein Sequence
MDFFQYFFRYYWQLVYMICLMLYITMYILIYNFTGKTLQTVKYFLYPSCTAMLIAMTMAF ATQTRNIDNTHSMALLCDGFCKYIGPTFCFYCYNLYTAFGIVVNLINLHTMYYRTLCLKY LDAKKVRLWTLVFMWHYLCPLIYLIVIITSPQRHLEVSMETLSLHPNFDYTPYLTFGGFS QAQKELLDKAAMSLSLISMYYPLIGTYWKHKAMKMLKSHMSPNTSDATRAMLQTLIKGLN FQILLPMLRYIPLTAIYFMIKYTGEQFLISQYTITVLGTIPCILDPLVQIYFIRDAIRKF LACNSSPVRRIYDSWASRMII
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_F13A7.2

UniGene: Cel.23680

Protein Families
Nematode receptor-like protein srd family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Serpentine receptor class delta-63 (srd-63) and what cellular functions does it regulate?

Serpentine receptor class delta-63 (srd-63) belongs to the G protein-coupled receptor (GPCR) superfamily characterized by their seven-transmembrane domain structure. These receptors are involved in cellular signaling pathways similar to the p53-mediated regulatory mechanisms. The receptor demonstrates functional characteristics comparable to deltaNp63alpha, which regulates cell proliferation and differentiation in epithelial tissues. While deltaNp63alpha serves as a master regulator of keratinocyte differentiation and is abundant in basal cells, srd-63 likely performs similar regulatory functions in its native cellular environment . The receptor plays crucial roles in cellular homeostasis through the transduction of extracellular signals into intracellular responses, affecting processes such as cell growth, differentiation, and metabolic regulation.

What expression systems are most effective for recombinant srd-63 production?

When producing recombinant srd-63, researchers should consider multiple expression systems based on experimental goals. For structural studies requiring high protein yields, bacterial systems like E. coli may be suitable with appropriate modifications to address membrane protein folding challenges. For functional studies requiring post-translational modifications, mammalian expression systems (CHO or HEK293 cells) are preferred, though they have lower yield. The choice of expression system should be guided by systematic experimental design principles as outlined in Design of Experiments (DOE) methodology . This approach allows researchers to systematically evaluate different expression conditions and identify optimal parameters through screening experiments, followed by optimization and robustness testing to ensure consistent protein quality and yield.

How do I optimize purification protocols for recombinant srd-63?

Purification optimization for recombinant srd-63 requires a methodical approach following DOE principles. Begin with a planning stage to define objectives and integrate prior knowledge about serpentine receptors . The screening stage should evaluate multiple purification methods (affinity chromatography, size exclusion, ion exchange) to identify the most promising approaches. During optimization, systematically adjust buffer compositions, detergent concentrations, and elution conditions to maximize yield and purity. Implement factorial designs to efficiently analyze multiple variables simultaneously . For example, a two-level factorial design can examine the effects of pH (low/high), salt concentration (low/high), and detergent type on purification efficiency. Response surface methods can then be applied to find optimal conditions that maximize both purity and yield while maintaining protein functionality .

How can I design experiments to investigate srd-63 ligand binding properties?

Designing experiments to investigate srd-63 ligand binding requires a structured approach incorporating both systematic and representative design principles. Begin by creating a default control group (DCG) that represents baseline binding conditions, then build experimental groups with systematic manipulations to test specific hypotheses about binding mechanisms . Employ a full factorial design when exploring multiple factors affecting binding (such as pH, temperature, ion concentration), as this allows for examination of both main effects and interactions between factors .

For high-throughput screening of potential ligands, consider highly fractional designs such as Plackett-Burman designs that can efficiently evaluate main effects with minimal experimental runs . When optimizing binding conditions for identified ligands, implement response surface method designs to determine settings of factors that achieve optimal binding affinity . Throughout the process, maintain randomization to control for confounding variables, and consider blocking designs when experiments must be conducted across multiple days or using different protein preparations to account for these sources of variation .

What are the best approaches to study the functional coupling of srd-63 with downstream signaling partners?

Investigating functional coupling of srd-63 with downstream signaling partners requires a multi-stage experimental approach. First, conduct screening experiments using fractional factorial designs to identify key signaling partners from potential candidates . These designs efficiently eliminate unimportant factors and focus attention on significant interactions. Second, apply two-level factorial experiments to systematically evaluate how different conditions (agonist concentration, incubation time, temperature) affect the coupling efficiency with identified partners .

For quantitative analysis of coupling dynamics, implement response surface methods to optimize conditions and find settings that maximize signal transduction . Throughout these stages, incorporate robust parameter design principles to ensure your experimental system produces reliable results despite variations in experimental conditions . This approach helps develop methods that are insensitive to noise factors. When studying temporal aspects of signaling, consider reliability DOE approaches that can handle time-series data and provide insights into the kinetics and durability of signaling responses .

How can I design experiments to investigate potential functional redundancy between srd-63 and related receptors?

To investigate functional redundancy between srd-63 and related receptors, implement a Systematic Representative Design (SRD) approach that combines rigorous causal inference with built-in generalizability . Begin by characterizing baseline functions of individual receptors, then systematically manipulate receptor expression patterns through genetic approaches (knockout, knockdown, overexpression) while measuring functional outcomes. This design should include:

  • A comprehensive receptor profiling phase using factorial designs to identify overlapping expression patterns and structural similarities .

  • Functional assays designed as two-level factorial experiments where factors include receptor expression levels (present/absent) for srd-63 and related receptors .

  • Analysis of interaction effects between receptors to detect compensatory mechanisms, using statistical methods that can detect both main effects and interactions .

  • Response surface methodology to quantify the relationship between expression levels and functional outputs, revealing potential threshold effects in redundancy mechanisms .

This approach allows for robust causal inference about redundancy while maintaining generalizability across different cellular contexts, providing insights that go beyond simple descriptive correlations to establish mechanistic understanding .

How should I address conflicting results when studying srd-63 functions across different experimental systems?

When confronted with conflicting results across different experimental systems, apply a systematic framework for reconciliation based on the principles of Systematic Representative Design (SRD) . First, evaluate the representativeness of each experimental system relative to the physiological context of srd-63 function. Consider whether the divergent results might reflect genuine biological differences across contexts rather than experimental artifacts.

Third, design validation experiments with careful attention to both systematic control (random assignment, controlled variables) and representative sampling of conditions . This might include conducting identical experiments across multiple systems simultaneously to directly compare outcomes. Throughout this process, engage in shared decision-making with collaborators, considering the current status of underlying findings and methodological approaches, similar to the approach recommended for complex clinical decisions .

What statistical approaches are most appropriate for analyzing dose-response relationships for srd-63 agonists/antagonists?

When analyzing complete dose-response curves, non-linear regression models such as four-parameter logistic (4PL) equations are preferred, as they can accommodate the sigmoidal shape typical of receptor responses. These models generate key pharmacological parameters including EC50/IC50 values, maximum efficacy, and Hill coefficients that characterize the potency and response profile of compounds.

For experiments investigating how multiple factors affect dose-response relationships, multiple linear regression analysis can identify significant predictors and interactions . When optimizing compound formulations or testing conditions, response surface methodology provides valuable insights into how different variables interact to influence potency and efficacy .

How can I determine if apparent changes in srd-63 expression levels are biologically significant versus technical artifacts?

Distinguishing between biologically significant changes in srd-63 expression and technical artifacts requires a multi-faceted approach combining experimental controls, statistical analysis, and validation methods. First, implement measurement system analysis (MSA) techniques to characterize the precision and accuracy of your expression quantification methods . This includes assessing repeatability (variation when the same operator measures the same sample multiple times) and reproducibility (variation when different operators measure the same sample).

Second, design experiments with appropriate technical and biological replicates, allowing for the decomposition of variance into components attributable to technical noise versus biological variation . Use statistical methods such as ANOVA to determine if observed differences exceed what would be expected from technical variation alone.

Third, validate expression changes using orthogonal methods. If initial measurements were made by qPCR, confirm with protein-level detection methods such as Western blotting or immunofluorescence. Include positive controls (genes known to change under your conditions) and negative controls (genes known to remain stable) in your analysis.

Finally, consider the magnitude of change in biological context. Even statistically significant changes may not be biologically meaningful if they fall below the threshold needed to affect downstream processes. Design validation experiments that directly test the functional consequences of observed expression changes to determine their biological significance .

What are the most effective approaches to troubleshoot poor expression of recombinant srd-63?

Troubleshooting poor expression of recombinant srd-63 requires a systematic approach based on Design of Experiments (DOE) methodology . First, during the planning stage, review literature on expressing similar serpentine receptors and catalog potential factors affecting expression. Second, implement a screening design, such as a fractional factorial experiment, to efficiently identify critical factors among multiple variables (expression vector, host strain, induction conditions, growth media, temperature) .

Once key factors are identified, optimize these parameters using response surface methodology to find optimal settings . For membrane proteins like srd-63, specific strategies include: (1) using specialized expression vectors with fusion partners (SUMO, MBP, Trx) to enhance solubility; (2) testing specialized host strains engineered for membrane protein expression; (3) exploring slower expression conditions (lower temperature, reduced inducer concentration) that allow proper folding; and (4) examining different detergents for solubilization.

If expression remains problematic, consider codon optimization for the host organism and screening for genetic toxicity effects. Throughout this process, implement randomization in your experiments to control for confounding variables and blocking when experiments must be conducted across different days or using different reagent batches .

How can I address non-specific binding issues in srd-63 interaction studies?

Addressing non-specific binding in srd-63 interaction studies requires a methodical troubleshooting approach based on robust parameter design principles . Begin by characterizing the nature of non-specific binding through systematic variation of experimental conditions. Design a two-level factorial experiment to evaluate factors that might contribute to non-specific binding, including buffer composition, detergent type/concentration, blocking agent, and sample preparation methods .

Implement specific methodological improvements based on experimental findings:

  • Optimize blocking procedures by testing different blocking agents (BSA, milk proteins, specific commercial blockers) at various concentrations and incubation times.

  • Modify wash protocols by adjusting stringency through variations in salt concentration, detergent type/percentage, and number/duration of washes.

  • Evaluate different immobilization strategies for the receptor or its binding partners to minimize exposure of non-specific binding sites.

  • Consider site-directed mutagenesis of non-essential surface residues that might contribute to non-specific interactions without affecting the binding site of interest.

Validate improvements by conducting specificity controls, including competition assays with unlabeled ligands and testing binding to structurally similar but functionally distinct receptors. Throughout this process, maintain scientific rigor through appropriate experimental controls and statistical validation of improvements .

What strategies can help resolve challenges in determining the specificity of antibodies against srd-63?

Resolving antibody specificity challenges for srd-63 detection requires a comprehensive validation strategy. Begin with systematic planning to identify potential cross-reactivity concerns based on sequence homology with related receptors . Design a screening experiment testing antibody performance across multiple validation methods .

Implement a multi-pronged verification approach:

  • Genetic validation: Test antibody reactivity in tissues/cells with genetic knockout or knockdown of srd-63. Absence of signal in these samples provides strong evidence for specificity. If working with model organisms, use appropriate genetic tools to create validation controls.

  • Peptide competition assays: Pre-incubate antibodies with increasing concentrations of immunizing peptides to demonstrate signal reduction in a dose-dependent manner.

  • Heterologous expression systems: Compare antibody reactivity in cells engineered to express recombinant srd-63 versus non-transfected controls.

  • Western blot analysis: Verify that detected bands match the predicted molecular weight, accounting for potential post-translational modifications.

  • Multiple antibody concordance: Compare staining patterns using antibodies targeting different epitopes of srd-63.

For quantitative assessment of antibody performance, apply measurement system analysis principles to evaluate precision (repeatability and reproducibility) and accuracy (using known standards when available) . Document validation results thoroughly to establish confidence in antibody specificity before proceeding with experimental applications.

What are promising approaches for studying the role of srd-63 in complex physiological processes?

Investigating srd-63's role in complex physiological processes requires integrating advanced methodologies with systematic experimental design. A promising approach involves implementing Systematic Representative Design (SRD), which enhances both causal inference and built-in generalizability by creating experimental conditions that representatively sample from real-world physiological contexts . This approach allows researchers to study srd-63 function under conditions that more accurately reflect its native environment.

For in vivo studies, consider creating conditional knockout models using tissue-specific or inducible Cre-lox systems to examine srd-63 function in specific physiological contexts while avoiding developmental compensation. Complement genetic approaches with pharmacological interventions using highly selective agonists/antagonists developed through systematic optimization procedures .

Multi-omics integration represents another powerful strategy, combining transcriptomics, proteomics, and metabolomics data to place srd-63 signaling within broader physiological networks. Design these studies using principles of experimental design with appropriate randomization and blocking to control for confounding variables .

Finally, advanced imaging techniques such as in vivo optical imaging with genetically encoded biosensors can provide real-time visualization of srd-63 activity in living systems. When designing these complex experiments, follow the stages of DOE (planning, screening, optimization, robustness testing, verification) to ensure rigorous and reproducible results .

How can computational approaches enhance understanding of srd-63 structure-function relationships?

Computational approaches offer powerful tools for understanding srd-63 structure-function relationships when integrated with experimental validation. Begin by employing homology modeling based on crystallized structures of related serpentine receptors to predict the three-dimensional structure of srd-63. Enhance these models through molecular dynamics simulations that can reveal conformational dynamics and potential ligand binding pockets.

For studying ligand interactions, implement virtual screening approaches using docking simulations to identify potential binding partners from compound libraries. Apply machine learning algorithms to analyze structure-activity relationships from experimental binding data, generating predictive models for ligand affinity and functional outcomes.

To systematically explore how structural variations impact function, design computational experiments using factorial designs that systematically alter structural elements (transmembrane domains, loops, key residues) and predict functional outcomes . This approach allows efficient exploration of structure-function space before experimental validation.

Integrate computational predictions with experimental validation following Systematic Representative Design principles . Design experiments that test computational predictions across representative conditions to ensure generalizability of findings. Throughout this process, maintain scientific rigor by clearly distinguishing between computational predictions and experimentally validated results, and by quantifying uncertainty in computational models.

What collaborative research frameworks would accelerate progress in understanding srd-63 biology?

Accelerating progress in srd-63 biology requires collaborative frameworks that integrate expertise across disciplines while maintaining scientific rigor. Develop research consortia that connect researchers studying fundamental receptor biology with those investigating physiological and pathological contexts where srd-63 may play important roles. These collaborations should implement shared decision-making processes that consider multiple perspectives when designing research strategies, similar to approaches recommended for complex clinical decisions .

Establish standardized methods and reagents to enhance reproducibility across research groups. This includes developing validated antibodies, cell lines, and animal models that can be shared among consortium members. Implement systematic documentation of experimental conditions following Design of Experiments principles to facilitate meta-analysis of results across studies .

Create integrated data repositories that combine results from diverse experimental approaches, including biochemical, genetic, structural, and physiological studies. These repositories should be designed to capture both positive and negative results, reducing publication bias and providing a more complete picture of srd-63 biology.

Foster translational collaborations that connect basic research on srd-63 with potential clinical applications, following principles of Systematic Representative Design to ensure that laboratory findings generalize to real-world contexts . This approach bridges the gap between controlled laboratory experiments and complex physiological environments, accelerating the path from discovery to application.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.