Recombinant Serpentine receptor class epsilon-12 (sre-12)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please indicate your desired format in the order notes, and we will fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. For dry ice shipping, please communicate your request in advance, as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is established during production. If you have a preferred tag type, please inform us, and we will prioritize development with your specified tag.
Synonyms
sre-12; T07H8.7; Serpentine receptor class epsilon-12; Protein sre-12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-341
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
sre-12
Target Protein Sequence
MLLLHYFNLSHFQVNDHFYPHMRNFLYGETAFYVADTINMMFYIWVLFSAQQFHFNFTLV SGTQYVIHFFDNLAIIVMRLHSLLGFTDDFDIGSNVVFNGAMTFSVYCIVAAMCSLPFSI LERCFATRYLKDYEANSRAYISYALVFLLNFIGIIGAILLQNKNNTIFVVAFLMILNLFA LLTNQFLRTWNLKKYEECHSNVSIRFQRGGKYSLAKRFQISENIKSLHMLNFIILYMGFM NVCLVISVLFSSFDISPERQAICSLALDASIFFYSFAIPQIMTCFCHKWKVQTNTFRIRI GCLRTGKVNLEPLRDTFGGDMRGSVSMNRYFDQLQDSWENA
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_T07H8.7

UniGene: Cel.2402

Protein Families
Nematode receptor-like protein sre family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are serpentine receptors and how does sre-12 fit into this classification?

Serpentine receptors are membrane proteins characterized by their seven transmembrane structure, similar to G protein-coupled receptors (GPCRs). Serpentine receptor class epsilon-12 (sre-12) belongs to this family of receptors. In parasites like Plasmodium falciparum, four serpentine receptors have been identified: PfSR1, PfSR10, PfSR12, and PfSR25, all displaying GPCR-like membrane topology . These receptors are believed to participate in intracellular signaling cascades regulating various parasite functions. PfSR12 specifically has been identified as a potential purinergic receptor based on structural predictions and strong binding to ATP .

What is the typical expression pattern of serpentine receptors like sre-12 during the parasite life cycle?

Serpentine receptors show stage-specific expression throughout the parasite life cycle. For PfSR12 specifically, immunofluorescence assays have revealed that it is predominantly expressed in late intraerythrocytic stages, especially in schizonts . Some serpentine receptors like SR1 and SR10 have been reported to play roles in salivary gland sporozoites, functioning as putative receptors that participate in intracellular signaling cascades regulating parasite motility and host invasion . Understanding the temporal expression patterns provides crucial insights into when these receptors are functionally important during parasite development.

How do serpentine receptors contribute to parasite survival and pathogenesis?

Serpentine receptors play fundamental roles in parasite biology and pathogenesis. Studies suggest their involvement in various critical processes including parasite development within host erythrocytes . For PfSR12 specifically, research indicates a possible role in P2Y type purinergic signaling, which appears to be important for malaria pathogenesis . When purinergic receptor signaling is blocked using antagonists like Prasugrel, inhibition of parasite growth and development occurs, particularly affecting late erythrocytic stages . This inhibitory effect has been demonstrated both in vitro and in vivo using mouse experimental models, suggesting that these receptors are essential for parasite survival and could serve as promising drug targets for antimalarial development.

What signaling pathways are activated by serpentine receptors such as sre-12/PfSR12?

PfSR12 appears to activate a complex cascade of signaling events. Research using Bioluminescence Resonance Energy Transfer (BRET)-based biosensors has demonstrated that PfSR12 can trigger a Gq/PLC/IP3 signaling pathway in HEK293 cells . When stimulated by thrombin, PfSR12 mediates a cytosolic Ca²⁺ increase that is accompanied by diacylglycerol (DAG) formation and protein kinase C (PKC) activation . This signaling mechanism was confirmed through multiple approaches:

  • Using Obelin-based biosensors to detect calcium mobilization

  • DAG and PKC BRET-based biosensors to monitor downstream effects

  • Verification of Gq involvement using both Gq/11 knockout HEK293 cells and the Gq-selective inhibitor YM254890

Interestingly, further investigation revealed that PfSR12 itself is not a direct thrombin receptor, suggesting complex interactions with other cellular components to mediate its effects .

How do mutations in the ATP binding domain of sre-12/PfSR12 affect its function and parasite viability?

The ATP binding domain of PfSR12 appears crucial for its function as a putative purinergic receptor. Bioinformatics analysis has shown that PfSR12 (PF3D7_0422800) contains a consensus P-loop motif that potentially serves as a binding pocket for ATP . This structural feature supports its predicted role as a purinergic receptor. Experimental evidence demonstrates that Prasugrel, a purinoreceptor inhibitor, and the agonist ATP show specific binding to recombinant PfSR12, confirming its function as a purinergic receptor .

When this binding is disrupted, either through mutations or antagonists like Prasugrel, parasite growth and development are inhibited, particularly in late erythrocytic stages. This indicates that the ATP binding domain is essential for PfSR12 function and parasite viability. Future research involving site-directed mutagenesis of specific residues within this domain would provide more detailed insights into the structure-function relationship of this receptor and potentially identify key residues for targeted drug development.

What is the relationship between serpentine receptors and resistance to antimalarial drugs?

While direct evidence linking serpentine receptors to antimalarial drug resistance is still emerging, these receptors represent promising novel drug targets. Research has demonstrated that targeting PfSR12 with purinergic signaling antagonists like Prasugrel can inhibit parasite growth both in vitro and in vivo . This suggests that serpentine receptors operate through mechanisms distinct from traditional antimalarial targets.

What are the most effective methods for expressing and purifying recombinant serpentine receptors like sre-12?

Expressing and purifying functional serpentine receptors presents significant challenges due to their hydrophobic transmembrane domains. Based on research with related receptors, the following protocol is recommended:

Expression Systems:

  • Mammalian expression systems (HEK293 cells) for proper folding and post-translational modifications

  • Baculovirus-insect cell systems for higher yield

  • Cell-free expression systems for difficult-to-express variants

Purification Protocol:

  • Clone the receptor gene with an appropriate affinity tag (His6, FLAG, or GST)

  • Optimize expression conditions (temperature, induction time, media composition)

  • Solubilize membrane fractions using mild detergents (DDM, LMNG, or GDN)

  • Purify using affinity chromatography followed by size exclusion chromatography

  • Validate protein integrity using western blotting and functional assays

Critical Considerations:

  • Include stabilizing lipids or cholesterol analogs during purification

  • Consider protein engineering approaches (thermostabilizing mutations, fusion partners)

  • For functional studies, reconstitution into nanodiscs or liposomes may preserve activity better than detergent micelles

How can BRET sensors be optimized for studying serpentine receptor signaling pathways?

BRET (Bioluminescence Resonance Energy Transfer) sensors offer powerful tools for investigating serpentine receptor signaling in real-time with minimal invasiveness. Based on successful applications with PfSR12 , the following optimization strategies are recommended:

BRET Sensor Selection:

  • For calcium signaling: Obelin-based biosensors

  • For DAG formation: DAG BRET-based biosensors

  • For protein kinase activation: PKC BRET-based biosensors

  • For G protein coupling: G protein BRET sensors with appropriate donor-acceptor pairs

Optimization Parameters:

  • Donor-acceptor ratio: Titrate donor:acceptor expression to determine optimal ratio

  • Expression levels: Moderate expression prevents artifacts from overexpression

  • Cell density and health: Maintain consistent culture conditions

  • Signal detection window: Optimize measurement timing and duration

  • Control experiments: Include negative controls (inactive receptor mutants) and positive controls (direct stimulation of downstream effectors)

Data Analysis:

What controls are essential when conducting immunofluorescence assays to localize serpentine receptors in parasites?

Immunofluorescence assays (IFAs) are critical for determining the spatiotemporal expression of serpentine receptors in parasites. When localizing receptors like PfSR12 , the following controls and considerations are essential:

Essential Controls:

  • Antibody Specificity Controls

    • Pre-immune serum control

    • Peptide competition assay (pre-incubation with immunizing peptide)

    • Secondary antibody-only control

    • Knockout/knockdown parasite lines (if available)

  • Developmental Stage Controls

    • Include multiple parasite developmental stages to confirm stage-specific expression

    • Use established stage-specific markers as references

  • Co-localization Controls

    • Include markers for different subcellular compartments (plasma membrane, ER, Golgi)

    • Use markers for known interacting proteins

Technical Considerations:

  • Fix parasites using multiple methods (paraformaldehyde, methanol) as fixation can affect epitope accessibility

  • Optimize permeabilization conditions for transmembrane proteins

  • Use deconvolution or super-resolution microscopy for precise localization

  • Quantify signal intensities across different stages and compartments

How should researchers interpret contradictory results regarding receptor localization and function?

When facing contradictory data about serpentine receptor localization or function, researchers should follow this systematic approach:

Assessment Framework:

  • Evaluate Methodological Differences:

    • Compare antibody specificity and validation methods

    • Examine fixation and permeabilization protocols

    • Assess microscopy resolution and imaging parameters

    • Consider parasite strain differences

  • Consider Biological Complexity:

    • Receptors may shuttle between compartments depending on activation state

    • Different isoforms may localize differently

    • Protein complexes may mask epitopes in certain contexts

    • Post-translational modifications may affect localization and detection

  • Resolution Strategies:

    • Employ multiple, complementary localization techniques (IFA, fractionation, proximity labeling)

    • Use epitope-tagged versions at endogenous loci

    • Conduct time-course experiments to capture dynamic localization

    • Perform functional assays in parallel with localization studies

  • Reconciliation Framework:

    ScenarioInterpretation ApproachValidation Method
    Different localizations in different stagesMay reflect genuine biological variationStage-specific knockout/localization
    Antibody-dependent differencesLikely due to epitope accessibilityUse multiple antibodies against different epitopes
    Function-localization mismatchConsider signaling relay or indirect effectsProximity labeling, interactome studies
    Strain-dependent differencesMay reflect genuine biological variation or adaptationsCross-strain complementation

What statistical approaches are most appropriate for analyzing dose-response data with serpentine receptor antagonists?

When analyzing dose-response data for serpentine receptor antagonists like Prasugrel's effects on PfSR12 , the following statistical approaches are recommended:

Recommended Statistical Framework:

  • Curve Fitting:

    • Use nonlinear regression to fit dose-response curves

    • Apply four-parameter logistic model (4PL) for standard sigmoid curves

    • Consider variable slope models if Hill coefficient varies

    • For complex responses, evaluate biphasic or bell-shaped models

  • Parameter Extraction:

    • Calculate IC50/EC50 values with 95% confidence intervals

    • Determine maximum and minimum responses (Emax, Emin)

    • Extract Hill slopes to understand cooperativity

  • Comparison Methods:

    • For comparing multiple compounds: Extra sum-of-squares F test

    • For time-dependent effects: Two-way ANOVA with time and concentration as factors

    • For comparing across cell types/conditions: Consider global fitting with shared parameters

  • Robustness Analysis:

    Analysis TypeMethodApplication
    Outlier detectionROUT method (Q=1%)Identify experimental outliers
    Parameter stabilityBootstrap analysisGenerate confidence ranges
    Model selectionAIC/BIC criteriaCompare alternative curve models
    Residual analysisDistribution of residualsCheck for systematic deviations
  • Reporting Standards:

    • Always report both the model used and goodness-of-fit statistics

    • Include raw data points alongside fitted curves

    • Report both biological and technical replicates

    • Provide clear descriptions of normalization methods

How can researchers distinguish between direct and indirect effects when studying receptor-mediated signaling?

Distinguishing direct from indirect effects is crucial when studying serpentine receptor signaling. Based on research with PfSR12 , the following approach is recommended:

Differentiation Framework:

  • Temporal Resolution Analysis:

    • Measure response kinetics with high temporal resolution

    • Direct effects typically occur faster than indirect effects

    • Compare kinetics with known direct activators

  • Pharmacological Dissection:

    • Use selective inhibitors at each step of the signaling cascade

    • Apply Gq/11 knockout systems or inhibitors like YM254890

    • Employ calcium chelators or release inhibitors

    • Test PKC-specific inhibitors

  • Genetic Manipulation Approaches:

    • Use CRISPR/Cas9 to knockout or modify proposed intermediate components

    • Create mutant receptors with altered coupling capabilities

    • Express dominant negative versions of signaling proteins

  • Reconstitution Experiments:

    • Purify the receptor and minimal signaling components

    • Reconstitute in artificial membranes or cell-free systems

    • Test direct interactions using purified components

  • Decision Matrix:

    ObservationDirect Effect EvidenceIndirect Effect Evidence
    Response timingRapid (seconds to minutes)Delayed (minutes to hours)
    Persists in cell-free systemStrong evidenceUnlikely
    Requires additional cell componentsLess likelyMore likely
    Blocked by specific inhibitorsDepends on targetDepends on target
    Persists with signaling protein knockoutsLess likelyDependent on knockout

What are common pitfalls in recombinant expression of serpentine receptors and how can they be addressed?

Expressing functional serpentine receptors like sre-12 presents several challenges. Here are common pitfalls and solutions:

Expression Challenges and Solutions:

  • Protein Misfolding:

    • Issue: Hydrophobic transmembrane domains tend to aggregate

    • Solution: Lower expression temperature (16-20°C), add chemical chaperones (glycerol, DMSO), or use specialized host strains with enhanced folding capacity

  • Low Expression Yield:

    • Issue: Toxicity to host cells or poor translation

    • Solution: Use inducible promoters, optimize codon usage, try different fusion tags (SUMO, MBP, or Thioredoxin), or utilize specialized expression hosts

  • Post-translational Modification Issues:

    • Issue: Incorrect glycosylation or disulfide formation

    • Solution: Select appropriate expression system (mammalian cells for mammalian-like modifications), add oxidoreductases, or engineer out non-essential modification sites

  • Receptor Instability:

    • Issue: Rapid degradation after expression

    • Solution: Add protease inhibitors, express at lower temperatures, or introduce stabilizing mutations

  • Troubleshooting Guide:

    ProblemDiagnostic ApproachSolution Strategy
    No visible expressionWestern blot with tag antibodyTry different tags, check mRNA levels
    Inclusion body formationSolubility analysisRefold or use solubilization strategies
    Inactive proteinBinding/functional assaysScreen solubilization conditions
    DegradationSize analysis on gelAdd protease inhibitors, express at lower temperature
    AggregationSize exclusion chromatographyOptimize detergent/lipid composition

What strategies can help overcome inconsistent results in studies of receptor-ligand binding?

Receptor-ligand binding studies, particularly with serpentine receptors like PfSR12 and its binding to ATP or antagonists like Prasugrel , can yield inconsistent results. Here are strategies to address this challenge:

Consistency Enhancement Framework:

  • Sample Preparation Standardization:

    • Use consistent receptor preparation methods

    • Prepare fresh ligands and verify purity

    • Control buffer conditions precisely (pH, ionic strength)

    • Standardize protein:lipid or protein:detergent ratios

  • Orthogonal Binding Assessment:

    • Employ multiple binding assay technologies:

      • Radioligand binding

      • Surface plasmon resonance (SPR)

      • Microscale thermophoresis (MST)

      • Isothermal titration calorimetry (ITC)

      • Fluorescence-based techniques (FRET, BRET )

  • Control Implementation:

    • Include positive controls (known binders)

    • Use negative controls (non-binding mutants)

    • Implement competitive binding with known ligands

    • Test non-specific binding to relevant surfaces/membranes

  • Data Validation Checklist:

    Validation ApproachImplementationBenefit
    Replicate consistencyMinimum 3 biological replicatesEstablishes reproducibility
    Technical varianceMultiple measurements per sampleQuantifies measurement error
    Independent preparationDifferent protein batchesTests preparation-dependent effects
    Multi-laboratory validationCollaborative testingEliminates lab-specific artifacts
    Method comparisonCorrelation between techniquesValidates binding mechanism

How can researchers address challenges in translating in vitro findings to in vivo relevance for serpentine receptor function?

Translating in vitro observations about serpentine receptors to in vivo relevance presents significant challenges. Based on studies with PfSR12 , the following strategies are recommended:

Translation Framework:

  • Physiological Relevance Assessment:

    • Verify ligand concentrations match physiological ranges

    • Confirm receptor expression levels mirror in vivo conditions

    • Use primary cells or organoids when possible

    • Consider microenvironmental factors (pH, redox state, membrane composition)

  • Model Complexity Escalation:

    • Begin with simplified systems (purified proteins)

    • Progress to cellular models with endogenous receptor levels

    • Advance to ex vivo tissue preparations

    • Culminate with appropriate in vivo models

  • Pharmacological Validation:

    • Test multiple structurally diverse ligands/antagonists

    • Establish full pharmacological profiles (potency, efficacy)

    • Assess off-target effects comprehensively

    • Determine pharmacokinetic properties for in vivo translation

  • Cross-Species Considerations:

    • Compare receptor structure/function across relevant species

    • Address species-specific differences in signaling pathways

    • Consider parasite-host interaction dynamics

    • Validate findings in human samples where possible

  • Translation Assessment Metrics:

    ParameterIn Vitro MeasureIn Vivo Correlation
    PotencyIC50/EC50 valuesEffective dose in animal models
    EfficacyMaximum responseDisease parameter improvement
    KineticsResponse timingTemporal disease modification
    SelectivityOff-target profileSide effect observations
    ResistanceSelection in cultureEmergence in treated animals

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.