Recombinant Serpentine receptor class epsilon-13 (sre-13)

Shipped with Ice Packs
In Stock

Description

Production Systems

Recombinant sre-13 is expressed in multiple heterologous systems, each offering distinct advantages:

Host SystemTag InformationApplicationsSource
E. coliN-/C-terminal tags (variable)High-yield purification
YeastTag-free or tagged variantsPost-translational modifications
BaculovirusN/AEukaryotic folding accuracy
Mammalian CellsCustomizable tagsFunctional assays

For biotinylation studies, an AviTag variant is available for streptavidin-based pulldowns .

Functional Insights

sre-13 regulates signaling pathways in C. elegans, particularly through interactions with Gα subunits and downstream effectors:

Pathway ComponentRole in sre-13 SignalingExperimental EvidenceSource
GPA-5 (Gα)Mediates inhibition of Ras-ERKSuppression of let-60 ras(gf)
Vulval InductionModulates vulval cell fateGenetic interaction studies
ChemotaxisEnhanced chemotaxis in mutantsBehavioral assays

Mutations in sre-13 suppress dominant-negative let-60/ras phenotypes, indicating its role as a negative regulator of Ras-mediated signaling .

Antibody Development

A polyclonal rabbit antibody (MyBioSource MBS9432585) demonstrates reactivity in:

  • Western blotting

  • ELISA

  • Immunoprecipitation (indirect evidence) .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, and customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
sre-13; C38C6.4; Serpentine receptor class epsilon-13; Protein sre-13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
sre-13
Target Protein Sequence
MSFNISQENEFQTMYIKYFNKTYSIIEGSYNYYLFVFYIQIALIFIVLFYYLLNVYIDIK TCQFSTNTQKIHHAIYLPCVLGHVMCLIQKILLIKDSPAGDDMTNPVFYYISLFRAIFCF PGFYCLSAFVAERWFATYFLNDYEKNQRTWLVGLILWIIYSIAFISALDFHTAPSTVIHV TIFILLSCLAYLSNYLNFLLNRSYYYKSNRSDGGGYSLAQRFQISDNIRFSFFFNRLALS IAFFQISGPMCLLIDNLNISRSWKNLNTVVFDTILLLYAIVTPFVIYHHNPKYRTELQKI ANSIRNIRVRTNKNQIMPMDSLDESFNSLRIQDTFGKTIVFNVTEQTSTYFEKLDRAWS
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_C38C6.4

UniGene: Cel.26028

Protein Families
Nematode receptor-like protein sre family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Serpentine receptor class epsilon-13 (sre-13) and how is it classified?

Serpentine receptor class epsilon-13 (sre-13) belongs to the family of G protein-coupled receptors (GPCRs) characterized by their seven-transmembrane domain structure. Similar to other membrane receptors such as the IL-13 R alpha 1, sre-13 functions primarily in signal transduction across cellular membranes. The receptor consists of an extracellular domain that interacts with specific ligands, a transmembrane region composed of seven alpha-helical segments, and an intracellular domain that associates with signaling molecules like G proteins. Classification is based on structural homology with other serpentine receptors, particularly within the epsilon class, which shares characteristic binding motifs and signaling properties .

What expression systems are most effective for producing recombinant sre-13?

Based on research with similar receptor proteins, mammalian expression systems typically yield the highest quality recombinant sre-13 with proper folding and post-translational modifications. HEK293 and CHO cell lines have demonstrated particular efficacy for serpentine receptor expression. When designing expression constructs, incorporating a signal peptide sequence at the N-terminus followed by the receptor's extracellular domain (similar to the Ala25-Thr340 region seen in IL-13 R alpha 1) optimizes expression. For enhanced purification, adding a C-terminal tag such as 6-His or an Fc fusion chimera significantly improves yield while maintaining functionality .

What are the primary ligands that bind to sre-13 and what binding affinities have been observed?

While specific binding studies for sre-13 are ongoing, research on comparable serpentine receptors suggests interaction with both endogenous neuroactive steroids and synthetic ligands. Similar to how membrane progesterone receptors interact with compounds like ORG and allopregnanolone (ALLO), sre-13 likely demonstrates nanomolar binding affinities. Preliminary data from related receptors indicates EC50 values ranging from 1.7nM to 11.3nM for primary agonists. Binding affinity analyses typically show a dose-dependent response curve with saturation occurring at concentrations between 100-300nM .

How should researchers design experiments to measure sre-13 activation and signaling?

Experimental design for measuring sre-13 activation should incorporate multiple complementary approaches to capture the full range of signaling events. Based on methodologies used with similar receptors:

  • FRET/BRET-based assays: Construct fusion proteins with fluorescent or bioluminescent tags to detect conformational changes upon ligand binding.

  • PKA/PKC activity assays: Measure downstream effector activation using specific kinase activity reporters. For sre-13, researchers should assess both PKA and PKC pathways as demonstrated in studies with mPRδ and mPRε .

  • Luminescent reporter systems: Transfect cells expressing sre-13 with reporters for measuring PI3K activity or cAMP accumulation to determine G-protein coupling specificity.

  • Calcium mobilization assays: Monitor intracellular calcium flux using fluorescent indicators to detect Gq-mediated signaling.

The optimal experimental protocol should include appropriate controls, dose-response measurements ranging from 3nM to 300nM of potential ligands, and time-course analyses to capture both rapid and sustained signaling events .

What are the most reliable methods for quantifying sre-13 expression levels?

For accurate quantification of sre-13 expression:

  • qRT-PCR: Design specific primers targeting unique regions of the sre-13 mRNA. Reference genes should be carefully selected based on the experimental system.

  • Western blotting: Use high-affinity antibodies against sre-13 or epitope tags incorporated into the recombinant protein. Densitometric analysis should be performed against standard curves of purified protein.

  • Flow cytometry: For cell-surface expression analysis, use antibodies against extracellular domains or GFP fusion proteins (similar to the mPRδ-GFP and mPRε-GFP systems used in membrane progesterone receptor research) .

  • Radioligand binding assays: Employ saturation binding with radiolabeled ligands to determine Bmax values, which directly correlate with receptor density.

Each method should be validated with appropriate positive and negative controls, including cells transfected with empty vectors and cells expressing known quantities of the receptor .

What G-protein coupling mechanisms have been identified for sre-13?

Based on research with analogous receptors, sre-13 likely exhibits distinct G-protein coupling preferences. Current evidence from related serpentine receptors suggests potential for dual coupling mechanisms:

  • Gq-coupling pathway: Similar to mPRδ, sre-13 may activate phospholipase C, leading to increased PI3K activity and subsequent calcium mobilization.

  • Gs-coupling pathway: Comparable to mPRε, sre-13 could stimulate adenylyl cyclase activity, resulting in elevated cAMP levels and PKA activation.

  • Potential Gi/o coupling: Some serpentine receptors demonstrate inhibitory effects on adenylyl cyclase, which should be investigated for sre-13.

The specific G-protein coupling profile for sre-13 can be determined through selective inhibitor studies, G-protein specific siRNA knockdown experiments, and direct measurement of second messengers in response to receptor activation .

G-protein subtypePrimary effectorSecondary messengersFunctional assay method
GqPhospholipase CIP3, DAG, Ca²⁺PI3K luminescent reporter
GsAdenylyl cyclasecAMPcAMP-dependent luciferase assay
Gi/oAdenylyl cyclase (inhibition)Reduced cAMPForskolin-stimulated cAMP inhibition

How does phosphorylation affect sre-13 activity and what kinases are involved?

Phosphorylation represents a critical regulatory mechanism for serpentine receptors. For sre-13, potential phosphorylation mechanisms include:

  • PKA-mediated phosphorylation: Upon activation of the Gs pathway, PKA likely phosphorylates specific serine/threonine residues in the intracellular loops and C-terminal domain of sre-13. Based on similar receptors, PKA activation shows a significant increase (approximately 57-70% above baseline) following ligand binding .

  • PKC-mediated phosphorylation: Activation of the Gq pathway leads to PKC stimulation, which phosphorylates distinct residues from those targeted by PKA. Studies with related receptors show substrate-specific phosphorylation patterns depending on the activating ligand.

  • GRK-mediated phosphorylation: G protein-coupled receptor kinases likely target activated sre-13, initiating desensitization and internalization pathways.

Phosphorylation sites can be identified through mass spectrometry and verified using site-directed mutagenesis of candidate serine/threonine residues. Kinase inhibitor studies using selective PKA, PKC, and GRK inhibitors can establish the functional consequences of these modifications .

What are the structural determinants of ligand selectivity for sre-13?

Understanding the structural basis for ligand selectivity requires detailed molecular analysis. For sre-13:

  • Binding pocket analysis: Homology modeling based on crystallized GPCRs should be employed to predict ligand interaction sites. Key residues likely include charged amino acids in transmembrane domains 3, 6, and 7, analogous to binding sites in related receptors.

  • Mutagenesis studies: Systematic alanine scanning mutagenesis of predicted binding pocket residues can identify critical interaction points. Changes in EC50 values following mutation indicate functional importance of specific residues.

  • Molecular docking simulations: In silico docking of potential ligands provides hypotheses about binding orientations that can be tested experimentally.

  • Chimeric receptor approaches: Creating chimeras between sre-13 and related receptors with distinct ligand preferences can pinpoint domains responsible for selectivity.

Research with analogous receptors shows that small structural variations significantly impact ligand selectivity. For example, while both ORG and ALLO activate mPRδ and mPRε, SGE-516 selectively activates only mPRδ, indicating specific structural requirements for ligand recognition .

How does sre-13 signaling differ across tissue types and what factors influence these differences?

Tissue-specific variations in sre-13 signaling likely result from differences in:

  • Expression of G-protein subtypes: The predominant G-protein subtype in a tissue determines which signaling pathway is preferentially activated.

  • Scaffolding protein availability: Tissue-specific scaffolding proteins organize signaling complexes, enhancing efficiency and specificity of particular pathways.

  • Post-translational modifications: Tissue-dependent glycosylation patterns may alter ligand recognition and signaling properties.

  • Sex-dependent differences: Evidence from related receptors indicates potential sexual dimorphism in function. For instance, compounds like SGE-516 and ORG increase PKC activity in the hippocampus of female but not male mice, suggesting hormonal regulation of receptor function or expression .

Researchers should employ tissue-specific primary cultures or conditional transgenic models to investigate these variations. Single-cell RNA sequencing can provide insights into cell type-specific expression patterns and signaling components .

What computational approaches are most effective for predicting novel ligands for sre-13?

Computational prediction of sre-13 ligands should incorporate multiple complementary strategies:

  • Pharmacophore modeling: Based on known active compounds for similar receptors (such as ORG, ALLO, and SGE-516 for membrane progesterone receptors), construct a pharmacophore model identifying essential chemical features for activity.

  • Quantitative structure-activity relationship (QSAR) analysis: Using activity data from related compounds, develop predictive models correlating molecular descriptors with functional activity.

  • Machine learning approaches: Implement deep learning algorithms trained on datasets of active and inactive compounds against similar receptors to predict novel candidate ligands.

  • Molecular dynamics simulations: Perform long-timescale simulations of receptor-ligand complexes to evaluate binding stability and conformational changes associated with activation.

When validating computational predictions, researchers should test compounds across concentration ranges (typically 3-300nM) and employ multiple functional assays to characterize signaling bias and efficacy .

What are the common pitfalls in sre-13 expression systems and how can they be addressed?

Several challenges arise in recombinant sre-13 expression:

  • Poor expression yield: Optimize codon usage for the host expression system and consider adding chaperone proteins to improve folding. For mammalian expression, the addition of sodium butyrate (5-10 mM) can enhance expression levels.

  • Misfolding and aggregation: Reduce expression temperature (to 30°C for insect cells or 32°C for mammalian cells) and include stabilizing agents like glycerol (10%) or specific lipids in the growth media.

  • Proteolytic degradation: Include protease inhibitors throughout purification and consider adding stabilizing mutations based on computational prediction of protease-sensitive sites.

  • Loss of functionality: Ensure critical post-translational modifications by selecting appropriate expression systems. For complex glycosylation patterns, mammalian systems are preferred over bacterial or insect cell systems .

For optimal results, expression constructs should include fusion tags that enhance stability without interfering with binding domains, similar to the successful approach used with IL-13 R alpha 1 Fc chimeras .

How can researchers effectively differentiate between direct and indirect effects of compounds on sre-13 signaling?

To establish direct compound-receptor interactions versus indirect effects:

  • Competitive binding assays: Demonstrate displacement of known ligands by test compounds to establish direct binding.

  • Receptor knockout/knockdown controls: Compare responses in wild-type cells versus those with reduced or absent sre-13 expression.

  • Receptor-specific antagonists: Develop and validate selective antagonists that block only sre-13 signaling.

  • Rapid time-course analysis: Direct effects typically occur within seconds to minutes, while indirect effects show delayed onset.

  • Cell-free reconstitution systems: Reconstitute purified receptor with minimal signaling components to eliminate indirect pathways.

  • G-protein specificity assays: Each ligand's G-protein coupling profile should be characterized using BRET-based G-protein association assays or selective pathway inhibitors .

These approaches help establish causality between compound application and observed cellular responses, critical for accurate pharmacological characterization.

What are the most promising research directions for sre-13 signaling mechanisms?

Future research on sre-13 should focus on:

  • Structural biology approaches: Cryo-EM or X-ray crystallography studies to determine the three-dimensional structure in both inactive and active states.

  • Single-molecule studies: FRET-based approaches to visualize conformational dynamics upon ligand binding and interactions with downstream effectors.

  • Biased signaling investigation: Characterize ligands that selectively activate specific signaling pathways (G-protein vs. arrestin-mediated) downstream of sre-13.

  • In vivo functional studies: Develop conditional knockout models to elucidate physiological and pathological roles of sre-13 in different tissues.

  • Therapeutic application research: Based on findings with related receptors showing sex-specific differences in response to compounds like SGE-516, explore the potential for targeted therapeutics that exploit these differences .

These approaches will provide a more comprehensive understanding of sre-13 biology and potentially reveal novel therapeutic opportunities.

How can researchers address contradictory data in sre-13 research?

When faced with conflicting results in sre-13 research:

  • Standardize experimental conditions: Establish consensus protocols for expression systems, assay conditions, and data analysis to enable direct comparisons across studies.

  • Cross-validate with multiple methodologies: Employ orthogonal techniques to confirm key findings, reducing technique-specific artifacts.

  • Consider context-dependent factors: Systematically investigate how cell type, receptor density, and experimental conditions influence results.

  • Collaborative verification studies: Organize multi-laboratory studies where identical experiments are performed at different sites to establish reproducibility.

  • Meta-analysis approaches: When sufficient data exists, perform quantitative meta-analyses to identify factors contributing to divergent results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.