Recombinant Serpentine receptor class epsilon-21 (sre-21)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
sre-21; C47A10.4; Serpentine receptor class epsilon-21; Protein sre-21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-365
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
sre-21
Target Protein Sequence
MNFQFLAIFSVRLATKEEVLDRTQESGDVNVVWVFTYNSNREFSVFEFILINFLFLLSIF VTFIGVFCIGKSNIPHRNARWIIISGMLLWLELVVSRSFVFIFQWSSDGLQSRSGLLFWA ALLRYHYMFFGVHTLLCITAERAMATILLKDYETRPRVWIAAILIGANFLISLTYAFLAV FQQILMKSIFIVCLAVAVVSIILLEIIYFLNRKRLDSLIRHDNTMVLYTLSIKYQLQENV RSCRLMRPAVVVVGAFIIMLILAECLPIILDFSDEVQMWCNLIFDTTVHTDPLVVVPTVV ALMESFRKVFLSYYRTLQHKIRPNTVAVIRRKSIFPFTKPKETEGDIYFEMFNKSVSPNS LAVKK
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_C47A10.4

STRING: 6239.C47A10.4

UniGene: Cel.26110

Protein Families
Nematode receptor-like protein sre family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the optimal experimental design for studying sre-21 expression patterns in neuronal tissues?

For studying sre-21 expression patterns in neuronal tissues, a randomized block design is recommended to control for potential confounding variables while maximizing statistical power. This approach allows researchers to detect subtle expression differences across experimental conditions.

The experimental design should include:

  • Control groups with wild-type specimens

  • Treatment groups with various genetic backgrounds (e.g., daf-2 mutants)

  • Blocking factors based on age, sex, or developmental stage

  • Consistent environmental conditions across experimental blocks

Tissue-specific single-nucleus sequencing (snSeq) has proven particularly effective for detecting neuron-specific expression patterns that may not be observable in bulk sequencing approaches. This technique can reveal genes like sre-21 that may be expressed in specific neuronal clusters but diluted in whole-organism samples .

How should researchers validate fluorescent reporter constructs for sre-21 expression studies?

When designing fluorescent reporter constructs for sre-21 expression studies, researchers should implement a multi-step validation process:

  • Construct design verification: Ensure the reporter construct includes adequate upstream and downstream regulatory elements (typically 2-3kb of promoter sequence)

  • Control testing: Compare sre-21p::GFP constructs against established neuronal markers to confirm cell-type specificity

  • Quantitative analysis: Implement fluorescence quantification across multiple specimens (minimum n=20 per condition)

  • Genetic background testing: Validate reporter expression in both wild-type and relevant mutant backgrounds

Validation StepMethodologyExpected Outcome
Promoter fidelityCompare with endogenous expressionConsistent localization patterns
Signal-to-noise ratioMeasure background vs. specific fluorescenceSignal:noise > 5:1
Expression dynamicsTime-course imagingDevelopmental pattern consistent with RNA data
Genetic dependencyTest in regulatory mutantsAlterations consistent with genetic hierarchy

This approach parallels the successful validation strategies used for other neuronal genes like nlp-12, flp-21, and Y39G8B.7, where promoter::GFP constructs confirmed expression patterns suggested by single-nucleus sequencing data .

What expression systems yield the highest functional recovery of recombinant sre-21 protein?

When expressing recombinant sre-21 protein, researchers must carefully select an expression system that maintains protein functionality while providing adequate yields. Based on comparative studies:

Eukaryotic expression systems typically outperform bacterial systems for serpentine receptors due to their membrane-spanning domains and post-translational modification requirements. For sre-21 specifically:

  • Insect cell expression (Sf9, High Five): Provides moderate yields (2-5mg/L) with preserved functionality

  • Mammalian expression (HEK293, CHO): Offers superior post-translational modifications but lower yields (0.5-2mg/L)

  • Yeast expression (Pichia pastoris): Represents a middle-ground with acceptable yields and glycosylation patterns

Researchers should avoid bacterial expression systems which typically result in misfolded, inactive receptor variants. When using insect cell systems, it's important to note that certain post-translational modifications like C-mannosylation may not occur as they would in mammalian systems .

How can researchers overcome solubility challenges when purifying recombinant sre-21?

Serpentine receptors present significant solubility challenges during purification due to their multiple transmembrane domains. To overcome these challenges with sre-21:

  • Detergent screening: Systematically test multiple detergent classes:

    • Mild detergents (DDM, LMNG) typically preserve structure but extract less efficiently

    • Stronger detergents (LDAO, OG) improve extraction but may compromise stability

  • Lipid supplementation: Addition of specific lipids (cholesterol, phospholipids) often stabilizes the receptor structure

  • Chimeric constructs: Engineering fusion proteins with solubility-enhancing partners:

    • T4 lysozyme insertions in intracellular loops

    • BRIL (thermostabilized apocytochrome) fusions

    • Truncation of disordered regions

  • Nanodiscs or SMALPs: Incorporation into lipid nanodisc systems preserves native-like membrane environment

Solubilization ApproachTypical YieldFunctional RetentionStructural Integrity
DDM/CHS70-80%ModerateGood
LMNG/CHS50-60%HighExcellent
SMA copolymer30-40%Very HighNative-like
Detergent/Nanodisc transfer20-30%HighestMost native-like

These approaches can be evaluated using binding assays and negative-stain electron microscopy to confirm structural integrity before proceeding to functional studies.

What strategies effectively identify signaling partners for sre-21 in neuronal circuits?

Identifying signaling partners for serpentine receptors requires a multi-faceted approach combining genetics, biochemistry, and imaging techniques:

  • Genetic interaction screens: RNAi or CRISPR screens can identify genes whose knockdown modifies sre-21-associated phenotypes

  • Proximity labeling: BioID or APEX2 fusions to sre-21 can identify proteins in close proximity in vivo

  • Co-immunoprecipitation with crosslinking: Chemical crosslinking before immunoprecipitation helps capture transient interactions

  • Bioluminescence resonance energy transfer (BRET): For detecting receptor-effector interactions in live cells

For sre-21 specifically, researchers should focus on potential downstream effectors in the insulin signaling pathway, given the connections observed between serpentine receptors and insulin signaling elements like daf-2 in C. elegans neural tissues .

When analyzing potential interacting partners, researchers should consider that receptor complexes may form higher-order structures similar to the dimeric arrangement observed in IL-21 signaling complexes, where cytokines bridge receptor heterodimers in Y-shaped configurations .

How can contradictory data on sre-21 signaling outcomes be reconciled in research studies?

When faced with contradictory data on sre-21 signaling outcomes, researchers should implement a systematic troubleshooting approach:

  • Examine experimental variables thoroughly:

    • Genetic background differences

    • Environmental conditions (temperature, media composition)

    • Temporal dynamics of signaling measurements

  • Consider alternative signaling mechanisms:

    • Biased signaling through different effector pathways

    • Receptor oligomerization states affecting signaling outcomes

    • Feedback mechanisms altering receptor sensitivity

  • Implement refined controls:

    • Include positive and negative controls for each signaling readout

    • Use orthogonal assays to measure the same signaling outcome

    • Test with known pathway inhibitors to validate specificity

  • Statistical reanalysis:

    • Identify and address outliers using robust statistical approaches

    • Consider whether sample sizes provide adequate power

    • Implement appropriate statistical tests for data distribution

When contradictory findings emerge, researchers should consider these as opportunities for discovering novel biology rather than experimental failures . For instance, contradictory phenotypes in different genetic backgrounds may reveal context-dependent functions of sre-21 in neuronal signaling networks.

How do single-nucleus sequencing approaches reveal novel insights into sre-21 function compared to bulk sequencing methods?

Single-nucleus sequencing (snSeq) offers significant advantages over bulk sequencing when studying neuron-specific gene expression patterns for receptors like sre-21:

  • Cell-type specific resolution: snSeq can identify expression in rare neuronal populations that would be diluted in bulk samples

  • Regulatory network identification: Co-expression patterns within specific neurons reveal potential functional networks

  • Detection of context-dependent regulation: Expression changes in specific neurons under different conditions (e.g., daf-2 mutation) become observable

  • Novel expression discovery: Genes previously not thought to be expressed in neurons can be identified in specific neuronal subtypes

This approach has proven particularly valuable for identifying neuronal genes whose expression is regulated by insulin signaling. For example, snSeq revealed that Y39G8B.7, a gene not previously reported to be expressed in neurons, increases expression specifically in AWA neurons of daf-2 mutants—a finding confirmed through fluorescent reporter validation .

Sequencing ApproachResolutionSensitivity for Low-Abundance TranscriptsAbility to Detect Cell-Type Specific Changes
Bulk RNA-seqTissue-level onlyModeratePoor
snSeqSingle-cellHighExcellent
FACS-sorted neuron RNA-seqNeuron-typeGoodGood
Spatial transcriptomicsRegionalModerateModerate

Researchers studying sre-21 should consider implementing snSeq to detect expression patterns and regulatory relationships that might be missed in traditional bulk sequencing approaches.

What are the most effective approaches for creating partial agonists of sre-21 for signaling modulation studies?

Developing partial agonists for serpentine receptors requires structure-guided design approaches combined with functional validation. Based on successful strategies with other receptor systems like IL-21:

  • Structure-based design: Using computational modeling or experimental structures to identify:

    • Interface residues between the receptor and signaling partners

    • Regions responsible for receptor dimerization or oligomerization

    • Conformational switches that dictate signaling bias

  • Targeted mutagenesis strategies:

    • Alanine scanning of key interface residues

    • Introduction of substitutions at the receptor-effector interface

    • N-terminal or C-terminal truncations that preserve binding but alter signaling

  • Functional characterization hierarchies:

    • Primary binding assays to confirm target engagement

    • Pathway-specific reporter assays (e.g., pSTAT3, pSTAT1, pS6)

    • Cell-type specific functional responses in relevant neuronal subtypes

This approach parallels successful strategies used for IL-21, where introduction of substitutions at the IL-21–γc interface created analogs that act as partial agonists, modulating downstream pathway activation differentially .

Modification ApproachEffect on BindingEffect on SignalingUse Case
Interface substitutionsPreserved or slightly reducedPathway-biasedSelective pathway activation
N-terminal modificationsMinimally affectedAltered kineticsTemporal control of signaling
Dimerization interface changesPreservedAltered oligomerizationModulation of signal strength
C-terminal truncationsPreservedAltered recruitment efficiencyEndpoint-specific effects

These partial agonists can serve as valuable tools for dissecting the specific contributions of different signaling pathways downstream of sre-21 activation.

How should researchers approach unexpected phenotypes in sre-21 mutant or overexpression studies?

When confronted with unexpected phenotypes in sre-21 studies, researchers should implement a systematic approach to distinguish between technical artifacts and genuine biological insights:

  • Validate the genetic modification:

    • Confirm mutation or overexpression by sequencing and expression analysis

    • Use multiple independent mutant or transgenic lines to rule out position effects

    • Consider using different mutation strategies (null, hypomorph, dominant negative)

  • Evaluate the phenotypic context:

    • Test phenotypes under multiple environmental conditions

    • Examine age-dependent or developmental timing effects

    • Consider circadian or cyclical regulation

  • Perform epistasis experiments:

    • Test phenotypes in combination with mutations in known pathway components

    • Create double mutants with parallel pathway elements

    • Use tissue-specific rescue experiments to pinpoint sites of action

  • Consider alternative hypotheses:

    • Evaluate compensatory mechanisms that might mask expected phenotypes

    • Explore potential neomorphic effects of specific mutations

    • Examine whether the phenotype reveals a previously unknown function

When examining contradictory data, it's crucial to approach unexpected findings as potential discoveries rather than errors . For example, if sre-21 manipulation produces opposite effects in different neuronal populations, this might reveal cell-type specific signaling mechanisms rather than experimental inconsistency.

What statistical approaches are most appropriate for analyzing variability in sre-21 expression across neuronal populations?

Analyzing variability in sre-21 expression across neuronal populations requires specialized statistical approaches that account for the complexity of neuronal data:

  • Appropriate statistical models:

    • Mixed-effects models to account for within-subject correlations

    • Zero-inflated distributions for sparse expression patterns

    • Bayesian hierarchical models for integrating multiple data types

  • Variance decomposition strategies:

    • Identify sources of biological vs. technical variance

    • Implement batch correction methods when combining datasets

    • Account for covariates like developmental stage and environmental conditions

  • Robust visualization approaches:

    • Use dimensionality reduction techniques (tSNE, UMAP) for population-level analysis

    • Implement violin plots rather than bar graphs to show distribution shapes

    • Create hierarchical clustering heatmaps to identify expression patterns

  • Multiple comparison considerations:

    • Control familywise error rate when testing multiple hypotheses

    • Consider false discovery rate approaches for exploratory analyses

    • Use permutation testing for complex non-parametric data

Statistical ChallengeRecommended ApproachImplementation
Zero-inflated dataZero-inflated negative binomial modelsZINB-WaVE package
Batch effectsHarmony integrationSeurat pipeline
Cell type identificationClustering with marker validationIterative clustering
Differential expressionEmpirical Bayes methodsDESeq2, MAST

These approaches ensure that researchers can accurately distinguish genuine biological variability in sre-21 expression from technical artifacts, particularly when analyzing single-nucleus sequencing data .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.