Recombinant Serpentine receptor class epsilon-26 (sre-26)

Shipped with Ice Packs
In Stock

Description

Development and Production

Recombinant sre-26 is synthesized using heterologous expression systems to ensure high purity and reproducibility. Key steps include:

  • Cloning: The full-length sre-26 gene (1–359 aa) is inserted into expression vectors .

  • Expression: Optimized in E. coli or mammalian cells to maintain structural integrity .

  • Purification: Affinity chromatography followed by buffer exchange into glycerol-containing storage solutions .

Diagnostic Assays

sre-26 is utilized in ELISA for detecting ligand-receptor interactions or antibody responses. For example:

  • Sensitivity: Commercial ELISA kits using recombinant sre-26 demonstrate high specificity for target analytes .

  • Cross-reactivity: No reported cross-reactivity with unrelated proteins in standardized tests .

Vaccine Development

The protein is explored as a candidate antigen due to its:

  • Immunogenicity: Potential to elicit targeted immune responses in model organisms .

  • Stability: Retains activity under varied pH and temperature conditions .

Challenges and Limitations

  • Functional Data Gap: Limited studies on sre-26’s native ligands or downstream signaling pathways .

  • Structural Complexity: Membrane protein expression often requires optimization to prevent misfolding .

Future Directions

Research priorities include:

  1. Mechanistic Studies: Elucidating sre-26’s role in C. elegans physiology.

  2. Therapeutic Exploration: Testing its utility in targeted drug delivery systems.

  3. Biotechnological Optimization: Improving yield in mammalian expression systems .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
sre-26; Y57A10C.4; Serpentine receptor class epsilon-26; Protein sre-26
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
sre-26
Target Protein Sequence
MFIKLSSTNSTSIFWLPIFFYNEPYWAQCAISSAELPFYMLSAYVVFVSCRIMLKIQLFH DNLMYIGVPMFGSWFLLIAGKLITILYRVRILNVESVKIHENWVFWTDEPEKMLNVQSLD GLVPLLVAGFLEIHFGFSVIFVGLAIVTERVIASMLIDNYEQSTSLLIPISFIIIYQFLA ISISLGILFNILGLYVLNASWILCILIGTIMYYYIRKINTKWLQEMQNPNRKRVFTVSQQ FQVRENLGAIAIGKRLVFVVLATIVVMGFGIVALVLEITVLFFMHFGENTLFCYPLYIFL VVMNGHPAWKQEFRKYFPKIKIFKKVRPGLVSVEIVEDQKKKLSLETDTYFRQLKSAWT
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_Y57A10C.4

UniGene: Cel.28316

Protein Families
Nematode receptor-like protein sre family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Serpentine receptor class epsilon-26 (sre-26)?

Serpentine receptor class epsilon-26 (sre-26) is a seven-transmembrane (7-TM) domain protein belonging to the broader family of serpentine receptors. These receptors comprise one of the most widespread classes of membrane receptors found in diverse organisms including fungi, plants, and metazoans. The sre-26 protein specifically belongs to the epsilon class of serpentine receptors in Caenorhabditis elegans and is encoded by gene Y57A10C.4 . Like other serpentine receptors, it features a characteristic seven-transmembrane architecture with connecting loops of varying lengths. The protein contains 359 amino acids with a specific sequence that determines its structure and function .

How does sre-26 differ from other serpentine receptor classes?

Serpentine receptors are highly divergent despite sharing the conserved seven-transmembrane structure. Members within each family typically share only 25% amino acid sequence identity in the conserved transmembrane core region, while different families exhibit even less sequence similarity . The sre-26 belongs to the epsilon class, which has distinct structural characteristics compared to other classes like the sru (class U) receptors. For instance, comparing the amino acid sequences of sre-26 (O62489) with sru-26 (P83502) reveals significant differences in transmembrane domain organization, loop lengths, and N-terminal domains . These structural differences likely reflect functional specialization and different signaling mechanisms.

What is the functional significance of sre-26 in C. elegans?

While the precise physiological role of sre-26 requires further characterization, serpentine receptors in C. elegans generally function in chemosensation, neurotransmission, and developmental signaling pathways. Based on structural classification methodologies such as those employed by Inoue et al., serpentine receptors can be categorized into different functional classes. This classification suggests that sre-26 likely plays a role in sensory perception, possibly in response to environmental cues or pheromones . The specific ligands that activate sre-26 remain to be definitively identified, making this an active area of research in C. elegans molecular biology.

What expression systems are optimal for recombinant sre-26 production?

  • Post-translational modification requirements

  • Need for proper membrane integration

  • Quantity of protein required

  • Downstream applications (structural vs. functional studies)

What are the critical considerations for purifying recombinant sre-26?

Purification of membrane proteins like sre-26 presents significant challenges due to their hydrophobic nature and requirement for a membrane environment. A methodical approach typically involves:

  • Appropriate detergent selection for solubilization (commonly DDM, LMNG, or digitonin)

  • Affinity chromatography using tags (His, FLAG, or other fusion tags)

  • Size exclusion chromatography for final purification

  • Quality control by SDS-PAGE and Western blotting

Researchers should avoid repeated freeze-thaw cycles, as this can significantly reduce protein activity. For storage, maintaining aliquots at -20°C to -80°C with the addition of 50% glycerol has been demonstrated to preserve stability . The storage buffer composition (typically Tris/PBS-based, pH 8.0) should be optimized specifically for sre-26 to maintain stability .

How can researchers validate the structural integrity of purified sre-26?

Validation of structural integrity is crucial for ensuring that purified sre-26 maintains its native conformation. Several complementary approaches should be employed:

  • Circular dichroism (CD) spectroscopy to assess secondary structure content

  • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to confirm monodispersity

  • Limited proteolysis to evaluate folding quality

  • Thermal stability assays to determine protein stability

  • Ligand binding assays if known ligands are available

These methods collectively provide confidence that the purified protein maintains its native structure and is suitable for downstream applications. Purity of >90% as determined by SDS-PAGE is generally considered acceptable for most research applications .

What experimental designs are most effective for studying sre-26 function?

Effective experimental designs for studying sre-26 function should incorporate multiple complementary approaches:

ApproachMethodologyKey Considerations
GeneticCRISPR/Cas9 gene editing, RNAiControls for off-target effects, validation by multiple methods
BiochemicalLigand binding assays, Surface Plasmon ResonanceAppropriate positive/negative controls, protein stability
StructuralCryo-EM, X-ray crystallographyDetergent selection, construct optimization
CellularCalcium imaging, BRET/FRET assaysCell type selection, signaling pathway knowledge
In vivoBehavioral assays in C. elegansEnvironmental variables, statistical power

The design of experiments (DOE) methodology is particularly valuable for systematically varying multiple parameters and identifying optimal conditions for sre-26 activity assays . This approach allows researchers to predict outcomes by systematically changing preconditions (independent variables) and observing their effects on dependent variables, while controlling for external factors.

How can contradictory data in sre-26 research be reconciled?

Contradictions in sre-26 research data may arise from variations in experimental conditions, genetic backgrounds, or methodological differences. A systematic approach to reconciliation includes:

  • Detailed comparison of methodologies, including expression systems, purification methods, and assay conditions

  • Standardization of key protocols across laboratories

  • Meta-analysis of published data to identify consistent patterns

  • Collaborative studies with shared reagents and protocols

  • Investigation of potential strain-specific or context-dependent effects

Researchers should ensure detailed documentation of methods, particularly regarding protein handling, storage conditions, and experimental variables that might influence receptor function . Reproducibility challenges are common in membrane protein research and should be addressed through rigorous experimental design with appropriate controls and statistical approaches.

What are the advanced applications of recombinant sre-26 in C. elegans research?

Recombinant sre-26 enables several sophisticated research applications:

  • Structure-function relationship studies: Systematic mutagenesis coupled with functional assays to map critical residues

  • Interactome mapping: Identifying protein interaction partners using techniques such as proximity labeling or co-immunoprecipitation

  • Drug discovery: Development of modulators (agonists/antagonists) for probing physiological functions

  • Biosensor development: Creating chimeric proteins for monitoring cellular responses to environmental stimuli

  • Comparative studies: Evolutionary analysis across nematode species to understand receptor specialization

What are the major challenges in expressing full-length sre-26?

Expressing full-length serpentine receptors like sre-26 presents several technical challenges:

  • Toxicity to host cells: Overexpression of membrane proteins can disrupt host cell membranes

  • Protein misfolding: 7-TM proteins often misfold when overexpressed

  • Low expression yields: Membrane proteins typically express at lower levels than soluble proteins

  • Post-translational modifications: Requirements for specific modifications may limit host selection

Solutions include using inducible expression systems, specialized host strains, fusion partners to enhance folding, and optimized growth conditions. For particularly challenging constructs, cell-free expression systems may be considered as an alternative approach .

How should researchers approach epitope tagging of sre-26?

Strategic epitope tagging is critical for detection and purification of sre-26. Considerations include:

  • Tag position: N-terminal tagging may be preferable as C-terminal domains often participate in signaling

  • Tag type: His-tags are common for purification, while FLAG or HA tags may be preferred for immunodetection

  • Linker design: Flexible linkers can minimize interference with protein folding

  • Validation: Functional assays should confirm that tagging does not alter receptor properties

The exact tag type should be determined during the production process based on experimental requirements and protein behavior . Multiple constructs with different tag configurations may need to be tested to identify optimal designs.

What are the best approaches for studying sre-26 interactions with potential ligands?

Investigating sre-26 interactions with potential ligands requires multiple complementary approaches:

  • In silico prediction: Computational modeling based on structural homology and docking simulations

  • Thermal shift assays: Measuring changes in protein stability upon ligand binding

  • Surface Plasmon Resonance (SPR): Direct measurement of binding kinetics and affinity

  • Fluorescence-based assays: FRET or fluorescence polarization to detect binding events

  • Functional assays: Measuring downstream signaling events following receptor activation

These approaches should be combined with rigorous controls and statistical analysis to establish confidence in identified interactions. Cross-validation using multiple techniques is essential for confirming true interactions versus experimental artifacts.

What emerging technologies might advance sre-26 research?

Several cutting-edge technologies have potential to significantly advance sre-26 research:

  • Cryo-electron microscopy: For high-resolution structural determination without crystallization

  • AlphaFold and other AI approaches: For structure prediction and drug discovery

  • Advanced optogenetics: For precise temporal control of receptor activation in vivo

  • Microfluidic organ-on-chip models: For more physiologically relevant functional studies

  • Single-cell transcriptomics: For understanding receptor expression patterns at cellular resolution

These technologies can provide unprecedented insights into receptor structure, dynamics, and physiological roles that have been challenging to address with conventional approaches.

How might understanding of sre-26 contribute to broader serpentine receptor research?

Research on sre-26 contributes to the broader understanding of serpentine receptors in several ways:

  • Providing comparative data for evolutionary studies of receptor diversification

  • Establishing methodological approaches applicable to other membrane receptors

  • Illuminating fundamental principles of receptor-ligand interactions in the epsilon class

  • Creating frameworks for functional classification based on structural features

  • Developing tools and resources that benefit research on related receptors

Insights from C. elegans sre-26 may have particular relevance to understanding serpentine receptors in parasitic nematodes and potentially inform therapeutic approaches for parasitic diseases .

What are the unresolved questions in sre-26 biology that merit investigation?

Several critical questions remain unresolved in sre-26 biology:

  • Endogenous ligand identification: What molecules activate sre-26 in its natural context?

  • Signaling pathways: What G-proteins or effectors couple to sre-26, and what downstream pathways are activated?

  • Developmental regulation: How is sre-26 expression regulated throughout development?

  • Functional redundancy: To what extent do other serpentine receptors compensate for sre-26 deficiency?

  • Evolutionary conservation: How conserved is sre-26 function across nematode species?

Addressing these questions will require integrated approaches combining genetics, biochemistry, structural biology, and in vivo studies in C. elegans.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.