Recombinant Serpentine receptor class epsilon-27 (sre-27)

What is Serpentine receptor class epsilon-27 (sre-27)?

Serpentine receptor class epsilon-27 (sre-27) is a transmembrane protein expressed in Caenorhabditis elegans with a UniProt accession number O62488. It belongs to the broader family of G protein-coupled receptors (GPCRs) characterized by their seven-transmembrane domain structure. The full-length protein consists of 364 amino acids and is encoded by the gene sre-27, also known by its ORF designation Y57A10C.3 . As a member of the serpentine receptor family, sre-27 likely functions in chemosensation pathways that allow C. elegans to detect environmental stimuli.

What is the structural composition of recombinant sre-27?

Recombinant sre-27 is expressed with the complete amino acid sequence: MIIKNMDASTNVPYLWLPIFLYDEPILASQVIASIELILYSICLYIVVVSLKIFVQVRMFHLNFII LVAPFFGIWFELIIGKLITMCYQLSIFSIGNLEIRKFYVLWTDDSNKMLVVNSFEGLELLIIAGFMEYHYMF SVVFGAVAVAIERLAASVLIDNYESTNKIFIPIALTVFFQIIAITCSCLALFHKFTIITINGTWIVSCACSSI VFFLVERINLRWKAEMEHPRREKVYTISQRFQVKENIRALDLGKRLIFSELGTISIIGLIIATLLLELVPPS LVHIAENALFLNPFGICTVAMYSIPAWKKRYKNAFPSIFCFLMRLKNRKIDVQSMEPLEEFSKRIYEETNIHF AQLNESWT . The protein features characteristic transmembrane domains typical of serpentine receptors, with hydrophobic regions that span the cellular membrane and hydrophilic loops that extend into either the cytoplasm or extracellular space.

How does recombinant sre-27 differ from other serpentine receptor classes?

Recombinant sre-27 belongs to the epsilon class of serpentine receptors, which differs from other classes such as the alpha class exemplified by serpentine receptor class alpha-27 (sra-27). While both are transmembrane proteins expressed in C. elegans, they have distinct amino acid sequences and UniProt identifiers (O62488 for sre-27 versus Q19549 for sra-27) . The epsilon class may have evolved different ligand specificity and downstream signaling pathways compared to the alpha class, reflecting their potentially diverse roles in chemosensation or other cellular functions in the nematode.

What are the optimal storage conditions for recombinant sre-27?

Recombinant sre-27 should be stored at -20°C for regular use, or at -80°C for extended storage periods to maintain protein stability and activity. The protein is typically provided in a Tris-based buffer containing 50% glycerol, which helps prevent freeze-thaw damage . For working experiments, it is recommended to prepare small aliquots that can be stored at 4°C for up to one week to minimize freeze-thaw cycles. Repeated freezing and thawing should be avoided as this can lead to protein denaturation and loss of functional activity .

What methodologies are recommended for handling transmembrane proteins like sre-27?

When working with transmembrane proteins like sre-27, researchers should employ techniques that maintain the protein's native conformation. This includes using appropriate detergents or lipid environments during purification and experimental procedures. For functional studies, reconstitution into lipid bilayers or nanodiscs may be necessary to preserve the protein's natural environment. All manipulations should be performed at 4°C when possible to minimize protein degradation, and protease inhibitors should be included in buffers to prevent enzymatic breakdown of the sample.

What experimental approaches can be used to study sre-27 ligand binding?

To investigate ligand binding properties of sre-27, researchers can employ multiple complementary approaches. Surface plasmon resonance (SPR) can measure real-time binding kinetics between the receptor and potential ligands. Isothermal titration calorimetry (ITC) provides thermodynamic parameters of binding interactions. Fluorescence-based assays using intrinsic tryptophan fluorescence or extrinsic fluorescent probes can detect conformational changes upon ligand binding. For high-throughput screening, researchers might develop cell-based assays where sre-27 activation by potential ligands triggers measurable downstream signaling events.

How can researchers establish the in vivo function of sre-27 in C. elegans?

Investigating the in vivo function of sre-27 in C. elegans requires a multifaceted approach. CRISPR-Cas9 gene editing can generate knockout or knock-in strains to assess phenotypic consequences of sre-27 deletion or modification. RNAi-mediated gene silencing offers an alternative approach for reducing sre-27 expression. Behavioral assays measuring chemotaxis, thermotaxis, or other sensory responses can reveal defects in animals with altered sre-27 function. Tissue-specific rescue experiments, where wild-type sre-27 is expressed in specific neurons of knockout animals, can determine where the protein functions. Fluorescent reporter fusions can visualize sre-27 expression patterns and subcellular localization.

What structural biology techniques are suitable for characterizing sre-27?

For structural characterization of sre-27, researchers can employ X-ray crystallography, which requires obtaining protein crystals suitable for diffraction analysis. Cryo-electron microscopy (cryo-EM) has emerged as a powerful alternative that doesn't require crystallization and can capture different conformational states. Nuclear magnetic resonance (NMR) spectroscopy can provide insights into protein dynamics in solution. Molecular dynamics simulations can complement experimental data by predicting conformational changes and ligand interactions. For transmembrane proteins like sre-27, detergent micelles, nanodiscs, or lipidic cubic phase methods may be required to maintain native-like environments during structural studies.

How can differential expression of sre-27 be analyzed across developmental stages?

Analyzing differential expression of sre-27 across C. elegans developmental stages requires stage-synchronized cultures and precise RNA/protein extraction protocols. Quantitative PCR (qPCR) can measure transcript levels with high sensitivity. RNA sequencing (RNA-seq) provides genome-wide expression data, allowing comparison of sre-27 with other genes. Western blotting with specific antibodies can quantify protein levels. Immunohistochemistry or fluorescent reporter strains can visualize spatial expression patterns. Single-cell RNA-seq can reveal cell-type-specific expression profiles. The following table summarizes methodological approaches for developmental expression analysis:

How do sre-27 homologs compare across nematode species?

Comparative analysis of sre-27 homologs across nematode species provides evolutionary insights into receptor conservation and divergence. Sequence alignment tools like BLAST can identify homologs in related species such as C. briggsae, C. remanei, and more distant nematodes. Phylogenetic analysis can establish evolutionary relationships between serpentine receptors across species. Conservation of key functional domains suggests evolutionary pressure to maintain specific functions, while variable regions may indicate species-specific adaptations. Synteny analysis (examining gene order conservation) can reveal genomic rearrangements affecting serpentine receptor genes. Positive selection analysis can identify amino acid positions under selective pressure, potentially indicating functional importance.

What is known about the signaling pathways downstream of sre-27 activation?

While specific signaling pathways for sre-27 are not detailed in the available search results, serpentine receptors typically activate heterotrimeric G proteins upon ligand binding. Researchers investigating downstream signaling can employ calcium imaging to detect intracellular calcium changes following receptor activation. cAMP assays can measure changes in this second messenger. Phosphorylation studies using phospho-specific antibodies can track activation of downstream kinases. Protein-protein interaction studies using co-immunoprecipitation or proximity labeling can identify binding partners. Transcriptomic and proteomic analyses after receptor stimulation can reveal global cellular responses to sre-27 activation.

How can researchers address poor expression yields of recombinant sre-27?

When encountering poor expression yields of recombinant sre-27, researchers should consider optimizing multiple parameters. Codon optimization for the expression host can improve translation efficiency. Testing different expression systems (E. coli, yeast, insect cells, mammalian cells) may identify a more suitable host. For E. coli expression systems specifically, as mentioned in the search results for similar serpentine receptors, researchers should explore various strains, temperatures, and induction conditions . Fusion tags can enhance solubility, with N-terminal 10xHis tags being one option used for similar serpentine receptors . Cell-free expression systems provide an alternative approach for difficult-to-express membrane proteins.

What strategies can overcome aggregation issues with purified sre-27?

Protein aggregation is a common challenge when working with transmembrane proteins like sre-27. To overcome this issue, researchers should optimize buffer conditions including pH, ionic strength, and choice of detergent or lipid environment. Screening different detergents (non-ionic, zwitterionic, or mild ionic) at various concentrations may identify conditions that maintain protein solubility. Incorporating stabilizing agents such as glycerol or specific lipids can improve stability. Size exclusion chromatography can separate aggregated from properly folded protein. Temperature control during purification and storage is critical, with most manipulations performed at 4°C. Addition of reducing agents may prevent disulfide-mediated aggregation if applicable.

How might single-molecule techniques advance our understanding of sre-27 function?

Single-molecule techniques offer unprecedented resolution for studying individual sre-27 receptors. Single-molecule FRET (smFRET) can monitor conformational changes in real-time as the receptor interacts with ligands or signaling partners. Total internal reflection fluorescence (TIRF) microscopy can visualize membrane dynamics and receptor clustering. Optical tweezers or atomic force microscopy can measure mechanical forces associated with conformational changes. These approaches overcome limitations of ensemble measurements by revealing heterogeneity in receptor behavior, transient intermediates, and rare events. Integration with nanodiscs or supported lipid bilayers can provide native-like membrane environments for these studies.

What are the potential applications of sre-27 research beyond basic science?

While immediate commercial applications may not be evident, fundamental research on sre-27 has broader implications. Understanding serpentine receptor biology contributes to our knowledge of GPCR evolution and function across species. Given that many human diseases involve GPCR dysfunction, comparative studies may reveal conserved mechanisms relevant to drug development. Because nematode-specific receptors differ from mammalian counterparts, they present potential targets for anthelmintic drug development against parasitic nematodes that threaten human health and agriculture. The methodologies developed for sre-27 research may be applicable to other challenging membrane proteins of medical or biotechnological importance.