Recombinant Serpentine receptor class epsilon-29 (sre-29)

Shipped with Ice Packs
In Stock

Description

Gene Classification and Evolutionary Context

sre-29 is part of the sre (serpentine receptor) family in C. elegans, specifically class E (epsilon). These receptors are implicated in diverse signaling pathways, including sensory perception and developmental regulation .

Gene FamilyClassSpeciesRole
sre (serpentine receptor)Epsilon (ε)C. elegansSensory signaling, developmental cues

Notably, the sre family in C. elegans includes 28 predicted serpentine receptors, with sre-29 showing 28% identity to sre-2 .

Applications in Research and Development

sre-29 is primarily used as a tool in molecular biology and vaccine development:

**3.1. Vaccine Development

Recombinant sre-29 is utilized in vaccine research due to its structural similarity to serpentine receptors in pathogens. For example, C. elegans proteins are leveraged to study immune responses and receptor-ligand interactions .

**3.2. Molecular Biology Studies

  • Protein Purification: The His-tag enables affinity chromatography for high-purity isolation .

  • Structural Analysis: Full-length expression facilitates studies of receptor conformation and ligand binding .

Table 2: Comparative Analysis of C. elegans Serpentine Receptors

GeneClassSequence Identity to sre-29Proposed Function
sre-1Class E28%Sensory signaling
sre-2Class EN/ADevelopmental regulation
sre-32Class εN/ANeurotransmitter signaling

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
sre-29; F57G9.4; Serpentine receptor class epsilon-29; Protein sre-29
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-356
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
sre-29
Target Protein Sequence
MLIKINSNDIWLPIHFYDETFNFQLVLSIVELFSYLICAYILTLNIYIILKIKMFHRNLY ILAIPLFGIWFELIIGKLITIAYRLKILNPGFELGVHIEIWTSDPTRKLKVESVNGLELL IFGGFLQWHYMFTIIFGVLAIAVERVVASVLIENYESNTQLFIPLFLTVISQFLSISTSL ALLFQKVGPFLAQLPWIICCPFSAMAYFFVKKCNESFEREIRNPRRRRHFSVSQQFQVKE NLRALYLGTRLVFVVLSCIALCGIGITALFYDLIPPFCCHFVENFLFLHPYLSCLTAIFS VPQWKNEFREVSVLGRCLKIGRLKIESENAMEIQDSTKKMGTETDLYFQQLADSWI
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_F57G9.4

UniGene: Cel.27059

Protein Families
Nematode receptor-like protein sre family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Serpentine receptor class epsilon-29 (sre-29) and what organism does it come from?

Serpentine receptor class epsilon-29 (sre-29) is a transmembrane protein belonging to the serpentine receptor family expressed in Caenorhabditis elegans. The full-length protein consists of 356 amino acids and is encoded by the gene sre-29 (ORF name: F57G9.4). As a member of the epsilon class of serpentine receptors, it likely functions in chemosensation, allowing C. elegans to detect and respond to specific chemical signals in its environment . Serpentine receptors are characterized by their seven-transmembrane domain structure, which is common to G-protein coupled receptors (GPCRs) across species. The specific function of sre-29 within the C. elegans chemosensory system remains an active area of research, as the organism possesses a large and diverse set of these receptors for environmental sensing.

What expression systems are most effective for producing recombinant sre-29?

  • Bacterial Expression (E. coli): While demonstrated to be viable for sre-29, bacterial systems may present challenges for proper folding of transmembrane proteins. When using E. coli, specialized strains designed for membrane protein expression (such as C41(DE3), C43(DE3), or Lemo21(DE3)) often provide better results than standard strains. Fusion partners such as maltose-binding protein (MBP) or thioredoxin can improve solubility and folding.

  • Insect Cell Systems: Baculovirus-infected Sf9 or High Five cells often provide superior folding for complex transmembrane proteins compared to bacterial systems. This system offers more appropriate post-translational modifications and membrane insertion machinery.

  • Mammalian Expression: For functional studies requiring mammalian-like membrane composition and glycosylation, HEK293 or CHO cells may be preferable despite lower yields.

  • Cell-Free Systems: These can be advantageous for transmembrane proteins as they allow direct incorporation into nanodiscs or liposomes during synthesis.

The choice of expression tag (His-tag being common for sre-29) should be strategically positioned to minimize interference with protein function while facilitating purification . Expression conditions including temperature, induction parameters, and media composition should be empirically optimized for each system to balance yield with proper folding.

What are the optimal storage conditions for maintaining recombinant sre-29 stability?

Based on established protocols, recombinant sre-29 requires specific storage conditions to maintain structural integrity and functional activity. The recommended storage parameters include:

Storage PurposeTemperatureBuffer ConditionsAdditional AgentsDuration
Long-term storage-20°C to -80°CTris/PBS-based buffer (pH 8.0)50% glycerol or 6% TrehaloseMonths to years
Working aliquots4°CSame as stock bufferNo additional freeze-thawUp to one week
Experiment preparationOn iceExperiment-specific bufferAvoid detergents unless necessaryHours

It is strongly recommended to avoid repeated freeze-thaw cycles as they can significantly compromise protein integrity . When preparing the protein for storage, aliquoting into single-use volumes is essential to prevent the need for multiple freeze-thaw events. For lyophilized preparations, reconstitution should be performed according to manufacturer specifications, typically using deionized sterile water or an appropriate buffer. After reconstitution, the solution should be gently mixed rather than vortexed to prevent protein denaturation. The addition of protease inhibitors may be beneficial for extended storage periods to prevent degradation.

What are effective methodologies for studying ligand-binding properties of sre-29?

Investigating the ligand-binding properties of sre-29 requires specialized approaches suitable for transmembrane receptors. Several methodological frameworks can be employed:

  • Radioligand Binding Assays: This classic approach requires a radiolabeled ligand with affinity for sre-29. The receptor can be incorporated into membrane preparations or reconstituted into liposomes. Saturation binding experiments (using increasing concentrations of radioligand) and competition binding experiments (using a fixed concentration of radioligand and increasing concentrations of unlabeled competitors) can determine binding parameters including affinity (Kd) and binding site density (Bmax).

  • Fluorescence-Based Methods: Techniques such as Fluorescence Resonance Energy Transfer (FRET) or Fluorescence Polarization (FP) can monitor ligand binding without radioactivity. This requires either a fluorescently labeled ligand or a receptor construct with strategically placed fluorescent proteins or tags.

  • Surface Plasmon Resonance (SPR): This label-free technique allows real-time monitoring of binding kinetics. The recombinant sre-29 can be immobilized on a sensor chip, and potential ligands flowed over the surface. This provides association and dissociation rate constants in addition to equilibrium binding constants.

  • Isothermal Titration Calorimetry (ITC): This method measures heat changes during binding reactions, providing thermodynamic parameters including enthalpy (ΔH), entropy (ΔS), and binding stoichiometry.

  • Microscale Thermophoresis (MST): A newer technique requiring small sample amounts, MST measures changes in the movement of molecules along microscopic temperature gradients upon binding.

For all these methods, the membrane environment is crucial for maintaining proper receptor conformation. Detergent micelles, nanodiscs, or liposomes are typically used to provide this environment, with the choice depending on the specific experimental requirements and compatibility with the detection system.

How can functional activation of sre-29 be assessed in experimental systems?

Assessing functional activation of sre-29 requires methods that can detect receptor conformational changes and downstream signaling events. Several experimental approaches are applicable:

  • G-protein Coupling Assays: As a likely GPCR, sre-29 would couple to G-proteins upon activation. Measuring GTPγS binding to G-proteins or utilizing BRET/FRET biosensors that detect G-protein activation can provide direct measures of receptor function.

  • Calcium Mobilization Assays: If sre-29 couples to Gq proteins, intracellular calcium release can be monitored using calcium-sensitive fluorescent dyes (e.g., Fluo-4) or genetically encoded calcium indicators (e.g., GCaMP).

  • cAMP Assays: For Gs or Gi coupled pathways, changes in cAMP levels can be measured using enzymatic assays, FRET-based biosensors, or bioluminescence-based reporter systems.

  • β-Arrestin Recruitment: Receptor activation often leads to β-arrestin recruitment, which can be monitored using enzyme complementation assays (e.g., DiscoveRx PathHunter) or BRET/FRET approaches.

  • Conformational Biosensors: Direct detection of receptor conformational changes can be achieved using specifically designed intramolecular FRET sensors, where fluorophores are positioned to report on activation-induced structural rearrangements.

When implementing these assays, it is essential to include appropriate positive and negative controls. Positive controls might include receptors with known constitutive activity or well-characterized ligand-receptor pairs. Negative controls should include mock-transfected cells and inactive receptor mutants. Data analysis should account for baseline drift, non-specific responses, and cell-to-cell variability depending on the assay format.

How can mutagenesis studies reveal functional domains and critical residues in sre-29?

Mutagenesis studies provide powerful tools for understanding structure-function relationships in receptors like sre-29. A systematic approach to mutagenesis research includes:

  • Alanine Scanning Mutagenesis: This involves sequential replacement of amino acids with alanine (chosen for its neutral properties) to identify residues critical for function. For sre-29, this approach could focus on:

    • Predicted ligand binding pockets in extracellular domains

    • Transmembrane regions involved in conformational changes

    • Intracellular loops involved in G-protein coupling

    • C-terminal domains potentially involved in regulation

  • Structure-Guided Mutagenesis: Based on computational models or homology to related receptors, specific residues predicted to be functionally important can be targeted. For serpentine receptors, conserved motifs in transmembrane domains often play critical roles in activation mechanisms.

  • Domain Swapping: Exchanging domains between sre-29 and other serpentine receptors can help identify regions responsible for ligand specificity or signaling bias.

  • Post-Translational Modification Site Mutagenesis: Modification of predicted phosphorylation sites (similar to the phosphorylation studies of Rab29 at Ser185) can reveal regulatory mechanisms. For instance, if sre-29 contains serine, threonine, or tyrosine residues in intracellular loops or the C-terminus, these could be mutated to phosphomimetic (e.g., aspartate) or phosphorylation-deficient (e.g., alanine) residues.

Analysis of mutants should employ multiple complementary assays examining:

  • Surface expression (to distinguish expression/trafficking defects from functional defects)

  • Ligand binding properties (affinity, kinetics)

  • G-protein coupling efficiency

  • Downstream signaling activation

  • Receptor internalization and desensitization

Careful statistical analysis comparing mutant receptors to wild-type controls, with appropriate normalization for expression levels, is essential for meaningful interpretation of results.

What approaches can reveal the in vivo function of sre-29 in C. elegans chemosensation?

Understanding the in vivo function of sre-29 in C. elegans requires integrated approaches combining genetic, molecular, and behavioral methodologies:

  • Gene Knockout/Knockdown Strategies:

    • CRISPR-Cas9 gene editing to generate precise deletions or mutations

    • RNA interference (RNAi) for conditional knockdown

    • Rescue experiments reintroducing wild-type or mutant forms of sre-29 into knockout backgrounds

  • Reporter Gene Assays:

    • Promoter-GFP fusions to identify the specific neurons expressing sre-29

    • Translational GFP fusions to examine subcellular localization

    • Calcium imaging using GCaMP to monitor neuronal activity in response to potential ligands

  • Behavioral Assays:

    • Chemotaxis assays testing responses to diverse chemical compounds

    • Adaptation and sensitization protocols to assess plasticity of responses

    • Food-seeking behavior modifications in mutant versus wild-type worms

  • Comparative Studies:

    • Examination of sre-29 function across C. elegans strains from different ecological niches

    • Evolutionary analysis comparing sre-29 with homologs in related nematode species

  • Integrative Approaches:

    • Combining optogenetics with behavioral analysis to establish causal relationships

    • Electrophysiological recording from identified neurons in response to chemical stimuli

    • Connectomics approaches to place sre-29-expressing neurons in the context of neural circuits

Data analysis for these experiments should include robust statistical methods appropriate for the specific assay, such as automated tracking systems for movement analysis, appropriate normalization for reporter gene studies, and multivariate analysis for complex behavioral datasets. Careful control experiments, including sham treatments and genetic controls, are essential for distinguishing specific effects from background variability.

What are common challenges in recombinant sre-29 research and how can they be addressed?

Researchers working with recombinant sre-29 may encounter several methodological challenges. The following table outlines common issues and evidence-based solutions:

ChallengePossible CausesMethodological Solutions
Low expression yieldToxicity to host cells; Poor codon optimization; Protein instabilityUse specialized host strains; Optimize codon usage; Lower induction temperature; Express with fusion partners; Use inducible promoters with tight regulation
Improper foldingRapid expression rate; Inadequate chaperone activity; Insufficient membrane componentsReduce expression temperature to 16-20°C; Co-express with chaperones; Use membrane-mimetic environments during purification
Aggregation during purificationExposure of hydrophobic regions; Inadequate detergent concentration; Buffer incompatibilityScreen different detergents (DDM, LMNG, etc.); Include glycerol (10-20%) in buffers; Use gradient purification to separate aggregates
Loss of activity during storageFreeze-thaw damage; Oxidation; Proteolytic degradationAliquot for single use; Include antioxidants; Add protease inhibitors; Store with stabilizing agents like trehalose
Non-specific binding in assaysHydrophobic interactions; Charge-based interactions; Impurities in preparationOptimize buffer ionic strength; Include low concentrations of non-ionic detergents; Increase blocking agent concentration; Pre-clear samples

When troubleshooting expression problems, systematic variation of conditions is more effective than random changes. Documentation of all parameters, including exact buffer compositions, temperatures, and timing, is essential for reproducibility. When analyzing data from troubleshooting experiments, paired statistical tests comparing modifications to a standard protocol can identify significant improvements, while controlling for batch-to-batch variability.

How should contradictory experimental results with recombinant sre-29 be interpreted and resolved?

When facing contradictory results in sre-29 research, a systematic approach to resolution includes:

  • Review Experimental Conditions: Small differences in protein preparation, buffer composition, or assay conditions can significantly impact results. A detailed side-by-side comparison of methodologies may reveal critical variables. For membrane proteins like sre-29, the lipid or detergent environment is particularly influential on function.

  • Examine Protein Quality: Different preparations of recombinant sre-29 may vary in:

    • Purity (assessed by SDS-PAGE)

    • Folding (evaluated by circular dichroism spectroscopy)

    • Aggregation state (determined by size exclusion chromatography or dynamic light scattering)

    • Post-translational modifications (identified by mass spectrometry)

  • Consider Tag Interference: The position and nature of affinity tags can affect protein function. N-terminal tags might interfere with signal sequence processing, while C-terminal tags could disrupt G-protein coupling. Comparing tagged versus tag-cleaved preparations can reveal such effects.

  • Analyze for Confounding Factors: Experimental artifacts may arise from:

    • Reagent contaminants (particularly endotoxins in E. coli preparations)

    • Equipment calibration differences

    • Cell passage number in cell-based assays

    • Lot-to-lot variation in commercial reagents

  • Validate with Multiple Approaches: When contradictory results emerge from a single methodology, employing orthogonal techniques can clarify true biological phenomena versus method-specific artifacts. For example, if binding results differ between radioligand and fluorescence-based assays, surface plasmon resonance could provide a third perspective.

Resolution typically requires carefully designed experiments that systematically test hypotheses about the source of discrepancies. Statistical analysis should include measures of effect size (not just p-values) and confidence intervals to better assess the biological significance of apparent differences. Collaboration between laboratories using different approaches can be particularly valuable in resolving persistent contradictions.

How does sre-29 compare structurally and functionally with other chemosensory receptors?

Comparative analysis of sre-29 with other chemosensory receptors provides valuable insights into its evolution and potential functions. A comprehensive comparison should examine:

Methodologically, these comparisons require sophisticated bioinformatic approaches:

  • Multiple sequence alignments with appropriate gap penalties for transmembrane regions

  • Structure prediction algorithms optimized for membrane proteins

  • Phylogenetic tree construction using maximum likelihood or Bayesian methods

  • Positive selection analysis to identify rapidly evolving residues

The resulting data can be visualized using specialized tools that highlight conserved domains, variable regions, and evolutionary relationships. This comparative context helps researchers develop hypotheses about sre-29 function based on better-characterized related receptors, potentially guiding experimental design for functional studies.

How might advanced structural biology techniques advance understanding of sre-29?

Advanced structural biology approaches offer promising avenues for deeper insights into sre-29 function:

  • Cryo-Electron Microscopy (Cryo-EM): This technique has revolutionized membrane protein structural biology by:

    • Enabling visualization of proteins in near-native environments

    • Requiring smaller sample amounts than crystallography

    • Capturing multiple conformational states simultaneously

    • Allowing visualization of protein-protein complexes

    For sre-29 research, Cryo-EM could reveal:

    • The architecture of ligand binding pockets

    • Conformational changes associated with activation

    • Interactions with G-proteins or other effectors

  • X-ray Free Electron Laser (XFEL) Crystallography: This emerging technique offers advantages for challenging membrane proteins by:

    • Using microcrystals, circumventing the need for large, difficult-to-grow crystals

    • Providing time-resolved structural information

    • Minimizing radiation damage effects

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This method can:

    • Map dynamic regions of the protein

    • Identify conformational changes upon ligand binding

    • Provide insights even when high-resolution structures are unavailable

  • Molecular Dynamics Simulations: Computational approaches can:

    • Model protein behavior in membrane environments

    • Predict ligand binding modes and energetics

    • Simulate conformational transitions during activation

    • Guide rational design of mutations for functional studies

  • Integrative Structural Biology: Combining multiple techniques to overcome limitations of individual methods:

    • Low-resolution Cryo-EM maps with molecular modeling

    • Crosslinking mass spectrometry with computational docking

    • EPR spectroscopy with simulation-based refinement

These advanced approaches require specialized equipment and expertise but offer unprecedented insights into the molecular mechanisms of receptor function. Collaborative approaches involving structural biologists, biochemists, and computational scientists will likely be most productive. Data analysis requires sophisticated computational pipelines to integrate diverse datasets and build comprehensive structural models that can inform functional hypotheses.

What potential therapeutic applications might emerge from sre-29 research?

While initially focused on basic science, research on serpentine receptors like sre-29 may ultimately contribute to therapeutic innovations:

  • Model System for GPCR Drug Discovery: Insights from sre-29 structure and function could:

    • Reveal novel mechanisms of receptor activation applicable to human GPCRs

    • Identify previously unrecognized binding pocket architectures

    • Provide simplified systems for initial screening of modulatory approaches

  • Parasitic Nematode Control: C. elegans serves as a model organism for parasitic nematodes that affect:

    • Human health (causing diseases like ascariasis, hookworm infections, and filariasis)

    • Agricultural productivity (through plant-parasitic nematodes)

    • Livestock health (via numerous veterinary parasites)

    If sre-29 homologs in parasitic species prove essential for host-finding or other critical behaviors, they might represent novel targets for anthelminthic development.

  • Biosensor Development: Engineered versions of chemosensory receptors could be developed for:

    • Environmental monitoring of specific chemicals

    • Detection of toxic compounds in food or water

    • Medical diagnostics for disease biomarkers

  • Insecticide Resistance Management: Understanding chemosensory mechanisms in nematodes may provide insights into similar systems in agricultural pests, potentially revealing:

    • Cross-resistance mechanisms

    • Novel target sites for selective pest control

    • Strategies to overcome evolved resistance

The path from basic research to applications requires multidisciplinary collaboration among academic researchers, biotechnology companies, and public health organizations. Methodological approaches would include high-throughput screening, medicinal chemistry optimization, and extensive in vivo testing. Ethical considerations and regulatory requirements must be addressed throughout the development process, particularly for applications targeting human health or environmental release.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.