Recombinant Serpentine receptor class epsilon-30 (sre-30)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery details.
Note: All protein orders are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
sre-30; F57G9.2; Serpentine receptor class epsilon-30; Protein sre-30
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
sre-30
Target Protein Sequence
MIIHISNSSSYIWLSVYFYKEPLSLKLLISIFELSSCILCGYILNLSIFVMLKIQLFHKN LMFLTVPLFAIWHELIIGKFITIAYRLKIVNPGFELGEHTVFWTNDPDKTLEVAGSSGLE LLIFGGFLQWHTIYSIVFGILAVATERTIASVYIKDYESKERIYIPIILTIISQLLSISI SLAIITQSIGPFLARLPFVICAPLSVLVFLFIKHTNQSLLKEICNPKRTRIFTVSQQCQV KENLRALRLGTRLVVVVIFYISICGFGIAALTFGLIPAGFGHLIENFLFLHPYPICLTAM FSIPQWRDQFKKSILPFLNRRLAKIEQVVTVRIEVNVQNSSSVETDIYFRQLTESWT
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_F57G9.2

UniGene: Cel.27058

Protein Families
Nematode receptor-like protein sre family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How should researchers plan initial experiments with recombinant sre-30 protein?

When planning initial experiments with recombinant sre-30 protein, researchers should first consider the experimental design methodology. Following the principles of Design of Experiments (DOE), researchers need to clearly define independent variables (e.g., protein concentration, buffer conditions, temperature) and dependent variables (e.g., binding affinity, activity measurements) .

A methodological approach for initial experiments should include:

  • Hypothesis formulation: Define clear research questions about sre-30 function or properties

  • Variable identification: Determine independent, dependent, and control variables

  • Experimental controls: Include positive and negative controls specific to your experimental system

  • Statistical design: Consider sample size, replication, and randomization to ensure statistical validity

  • Protocol optimization: Pilot experiments to establish optimal conditions for protein handling

For novice researchers, I recommend starting with basic characterization experiments such as SDS-PAGE analysis to confirm protein purity, Western blotting to verify identity, and circular dichroism to assess secondary structure before proceeding to functional assays .

What expression systems are suitable for recombinant production of sre-30?

Expression SystemAdvantagesLimitationsRecommended for sre-30
E. coliFast growth, high yield, cost-effectiveLimited post-translational modifications, potential inclusion body formationBasic structural studies, antibody production
YeastEukaryotic PTMs, secretion possibleLonger production time than E. coliStudies requiring glycosylation
Baculovirus/Insect CellsComplex PTMs, better folding for membrane proteinsMore complex system, higher costFunctional studies, interaction assays
Mammalian CellsMost authentic PTMs, natural foldingHighest cost, lowest yield, slowStudies requiring precise mammalian PTMs

For most basic research applications, E. coli expression with a His-tag is sufficient and has been documented to produce protein with greater than 90% purity as determined by SDS-PAGE . For more advanced functional studies, consider insect or mammalian cell expression systems that may provide better folding for this serpentine receptor .

How can researchers design experiments to investigate sre-30 function in C. elegans neuronal signaling?

Investigating sre-30 function in C. elegans neuronal signaling requires a multi-faceted experimental approach that combines molecular, cellular, and behavioral techniques. C. elegans, with its 302 neurons and capacity for complex behaviors, provides an excellent model for studying serpentine receptor function in neuronal circuits .

A comprehensive experimental design should include:

  • Gene knockout/knockdown studies: Generate sre-30 deletion mutants using CRISPR-Cas9 or employ RNAi to knock down expression. Compare phenotypes to wild-type worms across multiple behavioral assays.

  • Reporter gene fusion: Create transgenic lines expressing sre-30::GFP to visualize expression patterns in the nervous system. This helps identify which neurons express the receptor.

  • Calcium imaging: Express calcium indicators in neurons that express sre-30 to monitor activity changes in response to potential ligands.

  • Behavioral assays: Implement quantitative behavioral tests comparing wild-type and sre-30 mutant worms, focusing on:

    • Chemotaxis assays

    • Thermotaxis assays

    • Mechanosensory responses

    • Learning and memory paradigms

  • Electrophysiological recordings: Record from identified neurons in wild-type versus mutant backgrounds to assess changes in electrical properties.

This comprehensive approach follows design of experiments principles by systematically controlling variables and establishing causal relationships between sre-30 function and neuronal signaling . When analyzing results, researchers should apply appropriate statistical methods to handle the inherent variability in behavioral and physiological measurements.

What are the best practices for analyzing structure-function relationships in recombinant sre-30?

A systematic approach should include:

  • Computational structural prediction:

    • Homology modeling using related serpentine receptors with known structures

    • Transmembrane domain prediction using algorithms specifically designed for membrane proteins

    • Molecular dynamics simulations to predict conformational changes

  • Site-directed mutagenesis strategy:

    • Identify conserved residues through multiple sequence alignment with other serpentine receptors

    • Design mutations targeting:
      a) The N-terminal extracellular domain (amino acids 1-50) for potential ligand binding sites
      b) Transmembrane domains for structural integrity
      c) Cytoplasmic loops for G-protein coupling sites

    • Create a library of mutants with single amino acid substitutions

  • Functional characterization of mutants:

    • Express wild-type and mutant proteins using the same conditions

    • Assess protein folding using circular dichroism spectroscopy

    • Measure ligand binding affinities using techniques like surface plasmon resonance

    • Test G-protein activation using in vitro assays

  • Data analysis framework:

    • Implement statistical analysis to identify significant differences between wild-type and mutant proteins

    • Create structure-function maps correlating specific residues with particular functions

    • Use regression analysis to establish quantitative relationships between structural parameters and functional outputs

This approach integrates multiple experimental techniques while carefully controlling variables to establish causal relationships between protein structure and function .

How should researchers approach experimental design when investigating potential ligands for sre-30?

Identifying ligands for orphan receptors like sre-30 presents significant challenges and requires a well-designed experimental approach. The following methodology incorporates principles from the design of experiments to systematically screen and validate potential ligands:

  • In silico screening phase:

    • Homology modeling of the sre-30 binding pocket based on related receptors

    • Virtual screening of compound libraries against the predicted binding site

    • Pharmacophore modeling to identify key chemical features for binding

  • Primary screening design:

    • High-throughput functional assays using heterologous expression systems

    • Reporter gene-based assays that measure downstream signaling

    • Membrane potential assays for rapid detection of receptor activation

    • Design experiment with appropriate statistical power by calculating minimum sample size needed to detect effects

  • Secondary validation phase:

    • Dose-response curves for promising candidates from primary screening

    • Competition binding assays with radiolabeled or fluorescent ligands

    • Analysis of structure-activity relationships among active compounds

  • In vivo validation in C. elegans:

    • Behavioral assays testing chemotaxis towards candidate ligands

    • Calcium imaging in neurons expressing sre-30 upon ligand exposure

    • Genetic validation using sre-30 mutants as negative controls

  • Data analysis framework:

    • Implement statistical tests appropriate for screening data (e.g., Z-factor analysis)

    • Control for multiple comparisons when testing numerous compounds

    • Bayesian analysis to continuously refine probability of true positives

This comprehensive approach provides methodological rigor by incorporating multiple levels of validation and controlling for potential confounding variables and false positives that are common in ligand screening assays .

What are the optimal conditions for expression and purification of recombinant sre-30?

The successful expression and purification of recombinant sre-30 protein requires careful optimization of multiple parameters. Based on available data, the following methodological approach is recommended:

Expression System Optimization:

  • E. coli has been successfully used for sre-30 expression with N-terminal His-tagging

  • BL21(DE3) strain is recommended due to its protease deficiency

  • Expression should be induced at OD600 of 0.6-0.8 with 0.5-1.0 mM IPTG

  • Lower induction temperature (16-18°C) for 16-20 hours improves folding and solubility

Purification Protocol:

  • Cell lysis using sonication or high-pressure homogenization in buffer containing:

    • 50 mM Tris-HCl, pH 8.0

    • 300 mM NaCl

    • 10 mM imidazole

    • Protease inhibitor cocktail

  • Affinity chromatography using Ni-NTA resin:

    • Binding: 10 column volumes of lysis buffer

    • Washing: 10 column volumes with lysis buffer containing 20-30 mM imidazole

    • Elution: Step gradient with 50, 100, 250, and 500 mM imidazole

  • Size exclusion chromatography for final polishing:

    • Buffer: 20 mM Tris-HCl, pH 8.0, 150 mM NaCl

The purified protein should achieve >90% purity as assessed by SDS-PAGE . For long-term storage, the protein is typically lyophilized or stored in buffer containing 50% glycerol at -80°C to prevent freeze-thaw cycles that can cause protein degradation .

How can researchers verify the structural integrity and function of purified recombinant sre-30?

Verifying the structural integrity and function of purified recombinant sre-30 requires a multi-technique approach to assess different aspects of protein quality:

  • Purity and Identity Verification:

    • SDS-PAGE analysis to confirm >90% purity

    • Western blotting using anti-His antibodies to confirm identity

    • Mass spectrometry for accurate molecular weight determination and sequence coverage

  • Structural Integrity Assessment:

    • Circular dichroism (CD) spectroscopy to analyze secondary structure elements

    • Fluorescence spectroscopy to assess tertiary structure through intrinsic tryptophan fluorescence

    • Thermal shift assays to evaluate protein stability

  • Functional Validation:

    • Ligand binding assays if known ligands are available

    • G-protein coupling assays for functional assessment

    • Surface plasmon resonance to measure interaction kinetics with potential binding partners

  • Quality Control Metrics:

Quality ParameterTechniqueAcceptance Criteria
PuritySDS-PAGE>90% single band
IdentityWestern Blot + MSCorrect MW (±0.1%) and peptide matches
Secondary StructureCD SpectroscopyCharacteristic α-helical pattern for transmembrane domains
StabilityThermal ShiftConsistent Tm across batches (±2°C)
FunctionalityBinding AssayKD within 2-fold of reference standard

When working with membrane proteins like sre-30, traditional structural approaches may be challenging. Therefore, researchers should consider reconstitution into membrane mimetics (nanodiscs, liposomes) for functional studies that better approximate the native environment .

What methodological approaches should be used for troubleshooting protein aggregation in sre-30 preparations?

Protein aggregation is a common challenge when working with recombinant serpentine receptors like sre-30 due to their hydrophobic transmembrane domains. A systematic troubleshooting approach includes:

  • Diagnostic Methods to Identify Aggregation:

    • Dynamic light scattering to measure particle size distribution

    • Size exclusion chromatography to quantify aggregates

    • Analytical ultracentrifugation for detailed aggregation analysis

  • Prevention Strategies During Expression:

    • Reduce expression temperature to 16-18°C

    • Use specialized E. coli strains designed for membrane proteins

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

    • Add chemical chaperones to growth media (e.g., 4% ethanol, 500 mM sorbitol)

  • Optimization of Lysis and Purification:

    • Include mild detergents in lysis buffer (0.1% DDM, 0.5% CHAPS)

    • Test different detergent:protein ratios

    • Add stabilizing agents (glycerol 10-20%, specific lipids)

    • Implement on-column refolding protocols during affinity purification

  • Experimental Design for Screening Conditions:

    • Implement factorial design to efficiently test multiple variables:

FactorLevel 1Level 2Level 3
DetergentDDM (0.05%)LMNG (0.01%)CHAPS (0.5%)
SaltNaCl (150 mM)NaCl (300 mM)NaCl (500 mM)
pH6.57.58.5
AdditivesNoneGlycerol (10%)Cholesterol (0.01%)
  • Long-term Storage Optimization:

    • Avoid repeated freeze-thaw cycles

    • Store working aliquots at 4°C for up to one week

    • For longer storage, maintain at -20°C/-80°C in buffer containing 6% trehalose

This methodological approach applies design of experiments principles to efficiently identify optimal conditions while controlling for variables that affect protein aggregation .

How can Short-Term Research Experiences (SRE) be designed around sre-30 for undergraduate students?

Designing a Short-Term Research Experience (SRE) around sre-30 for undergraduate students requires balancing scientific rigor with educational value. Research indicates that properly structured SREs can significantly impact students' scientific identity and persistence in science . Here's a methodological approach for creating an effective sre-30-focused SRE:

  • Learning Objectives Design:

    • Develop clear, measurable learning outcomes focused on both technical skills and conceptual understanding

    • Include objectives related to C. elegans handling, molecular techniques, and data analysis

    • Ensure progression from basic to more complex research tasks

  • Project Structure:

    • Week 1: Introduction to C. elegans as a model organism and basic laboratory techniques

    • Week 2: PCR amplification and cloning of sre-30 gene from C. elegans

    • Week 3: Expression of recombinant sre-30 protein and basic characterization

    • Week 4: Student-designed experiments investigating sre-30 properties

  • Assessment Framework:

    • Implement pre/post surveys using validated instruments like the Persistence in the Sciences (PITS) survey

    • Collect qualitative data through student interviews about their experiences

    • Assess learning through laboratory notebooks, final presentations, and reports

  • Implementation Considerations:

    • Provide adequate training in laboratory safety and technique before independent work

    • Create research teams of 2-3 students to promote collaborative learning

    • Schedule regular discussions of primary literature related to sre-30 and C. elegans

This approach applies evidence-based practices from successful SRE programs that have shown significant impacts on students' scientific identity and research skills . The progressive structure allows students to develop confidence while contributing meaningful data to the understanding of sre-30.

What methodological approaches should be used to investigate sre-30 expression patterns in C. elegans?

Investigating sre-30 expression patterns in C. elegans requires a comprehensive approach combining molecular, genetic, and imaging techniques. The following methodological framework provides a systematic way to characterize expression:

  • Transcriptional Reporter Construction:

    • Design a transcriptional fusion with the sre-30 promoter (approximately 2-3kb upstream of the start codon) driving fluorescent protein expression

    • Clone the construct into a suitable C. elegans expression vector

    • Create transgenic lines using microinjection or bombardment techniques

    • Generate at least three independent transgenic lines to control for position effects

  • Translational Reporter Analysis:

    • Create a GFP fusion to the C-terminus of the full sre-30 coding sequence including introns

    • Maintain the native promoter to preserve expression regulation

    • Compare expression patterns between transcriptional and translational reporters to identify potential post-transcriptional regulation

  • Temporal Expression Analysis:

    • Document expression throughout development from embryo to adult

    • Implement time-lapse microscopy to track expression changes

    • Quantify fluorescence intensity at different developmental stages

  • Spatial Characterization:

    • Use confocal microscopy for high-resolution imaging

    • Implement co-localization studies with established neuronal markers

    • Create a comprehensive expression map with identified neurons and tissues

  • Experimental Controls and Validation:

    • Perform in situ hybridization to confirm mRNA localization

    • Use single-cell RNA sequencing data to validate expression in specific cell types

    • Implement negative controls using promoterless reporters

How should researchers design experiments to investigate the role of sre-30 in C. elegans sensory function?

Investigating the role of sre-30 in C. elegans sensory function requires a comprehensive experimental design that combines genetic, behavioral, and physiological approaches. The following methodological framework provides a systematic approach:

  • Genetic Tool Development:

    • Generate null mutants using CRISPR-Cas9 to create precise deletions or insertions

    • Create tissue-specific rescue lines to determine site of action

    • Develop conditional expression systems (heat-shock promoters) for temporal control

    • Design RNAi constructs for knockdown experiments

  • Behavioral Assay Design:

    • Chemotaxis assays: Test responses to various chemical stimuli using standard chemotaxis plates

    • Electrotaxis assays: Measure responses to electrical stimuli

    • Thermotaxis assays: Assess navigation on thermal gradients

    • Learning paradigms: Test associative learning between stimuli

  • Physiological Measurements:

    • Implement calcium imaging using GCaMP in neurons expressing sre-30

    • Design microfluidic devices for controlled stimulus delivery during imaging

    • Perform electrophysiological recordings from identified neurons

  • Experimental Design Considerations:

    • Use factorial designs to test interactions between genetic background and environmental stimuli

    • Implement blinded scoring to prevent observer bias

    • Include wild-type and known sensory mutant controls in all experiments

    • Ensure adequate sample sizes based on power analysis (typically n≥30 worms per condition)

  • Data Analysis Framework:

    • Implement automated tracking software for unbiased behavioral quantification

    • Use appropriate statistical tests (ANOVA, post-hoc comparisons)

    • Create comprehensive models integrating behavioral and physiological data

This methodological approach adheres to the principles of experimental design by systematically controlling variables, implementing appropriate controls, and using multiple complementary approaches to establish the role of sre-30 in sensory function .

How should researchers approach contradictory results in sre-30 functional studies?

When faced with contradictory results in sre-30 functional studies, researchers should implement a systematic troubleshooting and reconciliation approach:

  • Methodological Analysis:

    • Compare experimental protocols in detail, identifying subtle differences in:

      • Protein preparation methods

      • Buffer compositions

      • Assay conditions (temperature, pH, incubation times)

      • Detection methods and their sensitivity

    • Evaluate whether differences in methodology could explain the contradictory results

  • Statistical Reassessment:

    • Review statistical analyses from contradictory studies

    • Consider whether adequate sample sizes were used

    • Evaluate whether appropriate statistical tests were applied

    • Recalculate effect sizes and confidence intervals

  • Biological Variables Evaluation:

    • Assess genetic background differences in C. elegans strains

    • Consider developmental stage variations

    • Evaluate environmental conditions during experiments

    • Analyze the specific isoforms of sre-30 being studied

  • Reconciliation Experiments:

    • Design experiments specifically to test hypotheses that would explain contradictions

    • Implement side-by-side comparisons of protocols

    • Use multiple complementary techniques to measure the same parameter

    • Consider collaborations with labs reporting contradictory results

  • Structured Decision Framework:

Source of ContradictionInvestigation ApproachResolution Strategy
Methodological DifferencesDirect protocol comparisonStandardize protocols across labs
Statistical IssuesReanalysis of raw dataImplement more rigorous statistical methods
Biological VariationSystematic testing of variablesIdentify specific conditions for each phenotype
Technical ArtifactsIndependent verificationDevelop more robust assays

This approach applies scientific methodology to contradiction resolution, treating contradictory results as valuable data points rather than failures . By implementing controlled experiments to specifically address contradictions, researchers can often uncover new biology or important methodological considerations.

What are the best practices for data normalization and statistical analysis in sre-30 binding assays?

Data normalization and statistical analysis are critical for obtaining reliable and reproducible results in sre-30 binding assays. The following methodological framework provides best practices based on experimental design principles:

  • Assay-Specific Normalization Strategies:

    • Direct Binding Assays:

      • Normalize to total protein concentration

      • Convert raw data to moles of ligand bound per mole of receptor

      • Account for non-specific binding using appropriate controls

    • Competition Assays:

      • Express results as percentage of control binding

      • Transform data to logit scale for improved linearity

      • Calculate IC50 values using nonlinear regression

  • Technical Normalization Considerations:

    • Include internal standards in each assay

    • Account for day-to-day variations using reference compounds

    • Normalize for receptor expression levels in cell-based assays

  • Statistical Analysis Framework:

    • Data Quality Assessment:

      • Test for normality using Shapiro-Wilk or Kolmogorov-Smirnov tests

      • Identify and address outliers using standardized methods (Grubbs test)

      • Assess homogeneity of variance

    • Appropriate Statistical Tests:

      • For comparison of binding parameters: t-test or ANOVA with post-hoc tests

      • For non-parametric data: Mann-Whitney or Kruskal-Wallis tests

      • For dose-response curves: Extra sum-of-squares F test

  • Advanced Analysis Approaches:

    • Implement global fitting for complex binding models

    • Use Bayesian methods for improved parameter estimation

    • Consider bootstrap analysis for confidence interval determination

  • Reporting Standards:

    • Report both normalized and raw data when possible

    • Clearly describe all normalization procedures

    • Present complete statistical information (test used, p-values, confidence intervals)

    • Include sample sizes and power calculations

How should researchers interpret changes in sre-30 expression levels across different experimental conditions?

Interpreting changes in sre-30 expression levels across experimental conditions requires a methodical approach that considers both biological significance and technical factors. The following framework provides a systematic method for robust interpretation:

  • Quantification Method Considerations:

    • qRT-PCR Analysis:

      • Use multiple reference genes validated for stability across conditions

      • Apply ΔΔCt method with efficiency corrections

      • Include technical and biological replicates (minimum n=3)

    • Protein Level Analysis:

      • Normalize to appropriate loading controls

      • Use quantitative Western blotting techniques

      • Consider absolute quantification using purified standards

  • Biological Significance Assessment:

    • Determine minimal fold-change threshold based on biological context

    • Calculate effect sizes to evaluate biological relevance

    • Consider expression changes in relation to established regulatory pathways

  • Experimental Design Considerations:

    • Account for time-dependent effects with appropriate time-course experiments

    • Consider tissue-specific versus whole-organism measurements

    • Evaluate dose-response relationships for treatments

  • Integrated Data Analysis Framework:

Expression ChangeTechnical ValidationBiological ValidationInterpretation Framework
Small (<2-fold)Confirm with multiple methodsAssess functional impactConsider as modulatory effect
Moderate (2-5 fold)Validate across samplesTest with genetic approachesLikely meaningful regulation
Large (>5-fold)Rule out technical artifactsConfirm causal relationshipPotential major regulatory event
  • Contextual Interpretation:

    • Compare expression changes to related genes in the same pathway

    • Correlate with phenotypic outcomes

    • Integrate with existing knowledge about sre-30 regulation

This methodological approach implements principles of experimental design by controlling for variables that might affect expression measurements and interpretation . By applying this framework, researchers can distinguish biologically meaningful changes in sre-30 expression from technical variations and contextual fluctuations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.