Recombinant Serpentine receptor class epsilon-33 (sre-33)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors such as storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
sre-33; W05H5.6; Serpentine receptor class epsilon-33; Protein sre-33
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
sre-33
Target Protein Sequence
MIINSNSSTIFSSIWLPVFFYVEPLDQQVIISILELMIYLVCIHLVNVSLHVALKIRLFH RNLYILALPMFGMWYELIIGKFITIAYRLKLLGLDFELGEHTAIWTNDPGKVLLVASLNG LELLIFGGFLQWHYMYSWIFGVLTVAVERVIASVLIENYESNTQNLMPAILLIISQFLSI SMAFGLLFQKVGPLSAHFPWMISCPISVAAYVFVKKVNESFRREIKNPGRKRIFTLSQQF QVKENLRVLHLGTRLVFAVLSFIGICGCGIAALHYKIVPSYYCHLIENVLFLNPFLIGLT AMLSIPQWKEQFMKSFLTVRLFRNRRKPVHIVVEIEECAKKKNDVETNLYFKQLANSWI
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_W05H5.6

UniGene: Cel.27955

Protein Families
Nematode receptor-like protein sre family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Serpentine receptor class epsilon-33 (sre-33) and what is its significance in research?

Serpentine receptor class epsilon-33 (sre-33) belongs to the superfamily of G protein-coupled receptors (GPCRs) characterized by their seven-transmembrane domain structure. This receptor is primarily studied in nematodes, particularly Caenorhabditis elegans, where it functions in chemosensation and environmental signal detection. The significance of sre-33 in research stems from its role in understanding fundamental principles of signal transduction, chemotaxis behavior, and neural circuit development. Methodologically, studying sre-33 requires expression system optimization, protein purification techniques, and functional characterization through both in vitro and in vivo approaches. Researchers typically employ genetic knockouts, fluorescent tagging, and electrophysiological recordings to elucidate its functional properties and interacting partners.

How is recombinant sre-33 produced for research applications?

Recombinant sre-33 production involves several methodological considerations:

  • Expression Systems Selection: Bacterial systems (E. coli) offer cost-effectiveness but may struggle with proper membrane protein folding. Eukaryotic systems (yeast, insect cells, mammalian cells) provide better post-translational modifications but at higher cost and complexity .

  • Vector Design: Optimize codon usage for the host system and incorporate appropriate fusion tags (His, FLAG, GST) for purification and detection. Include TEV or PreScission protease sites for tag removal if necessary for functional studies.

  • Membrane Protein Solubilization: Extract the receptor using detergents (DDM, LMNG, or digitonin) or nanodiscs to maintain native-like lipid environments.

  • Quality Control: Employ SEC-MALS (Size Exclusion Chromatography with Multi-Angle Light Scattering) and thermal stability assays to verify proper folding and stability.

When designing expression experiments, randomization principles are crucial to minimize batch effects and systematic errors. This includes randomizing expression conditions, purification batches, and analytical runs to identify truly optimal conditions rather than artifacts .

What experimental controls are essential when working with recombinant sre-33?

When designing experiments with recombinant sre-33, multiple controls must be implemented:

  • Expression Controls:

    • Empty vector expression to assess background/non-specific effects

    • Well-characterized GPCR expression (e.g., β2-adrenergic receptor) as positive control

    • Non-functional sre-33 mutant (point mutation in binding site) as negative control

  • Functional Assays:

    • Ligand-free baseline measurements

    • Known GPCR ligand-receptor pairs as system validation

    • Concentration gradients for dose-response relationships

  • Biophysical Characterization:

    • Denatured protein samples to establish fully unfolded baselines

    • Native membrane fractions versus purified protein comparisons

The experimental design should include at least three independent biological replicates with technical triplicates to ensure statistical validity. These controls help distinguish genuine receptor-specific effects from artifacts of the expression and purification process .

What experimental designs are most effective for studying sre-33 signaling pathways?

Effective experimental designs for sre-33 signaling pathway studies require systematic manipulation of variables while controlling for confounding factors:

  • Factorial Design Approach: Simultaneously test multiple variables affecting sre-33 signaling (ligand concentration, receptor density, G-protein subtypes) to identify interaction effects. This design is particularly valuable for complex signaling networks where multiple factors may exhibit synergistic or antagonistic effects .

  • Time-Course Experiments: Implement staggered sampling schedules to capture rapid (milliseconds to seconds) and prolonged (minutes to hours) signaling events following receptor activation.

  • Genetic Manipulation Strategies:

    • CRISPR-Cas9 knockout/knockin studies to assess receptor essentiality

    • Conditional expression systems (tetracycline-inducible) for temporal control

    • Domain swapping with related receptors to identify functional regions

  • Downstream Effector Analysis:

    • Phosphoproteomic profiling at multiple time points following receptor activation

    • Calcium imaging in real-time using genetically encoded indicators

    • cAMP accumulation assays using BRET/FRET-based sensors

The experimental design should incorporate randomization of treatment groups and blinding of analysis where possible to minimize experimenter bias. Statistical power calculations should be performed a priori to determine appropriate sample sizes for detecting biologically relevant effect sizes .

How can researchers resolve contradictory data in sre-33 research literature?

Addressing contradictions in sre-33 research literature requires a structured analytical approach:

  • Contradiction Classification: Categorize discrepancies as self-contradictory (inconsistencies within a single study), pairwise contradictions (conflicts between two studies), or conditional contradictions (conflicts emerging when considering three or more studies together) .

  • Methodological Comparison Matrix:

StudyExpression SystemPurification MethodFunctional AssayBuffer ConditionsKey Findings
Study 1HEK293TNi-NTA affinityGTPγS bindingpH 7.4, 150mM NaClHigh affinity for ligand X
Study 2Sf9 insect cellsFLAG immunoprecipitationCalcium fluxpH 7.0, 100mM NaClNo binding to ligand X
Study 3YeastTandem affinityBRET-based assaypH 8.0, 200mM NaClModerate affinity for ligand X
  • Experimental Variable Analysis: Systematically evaluate differences in:

    • Receptor constructs (full-length vs. truncated)

    • Post-translational modifications present in different expression systems

    • Membrane composition and receptor orientation

    • Detection sensitivity of different assay platforms

    • Data analysis and normalization methods

  • Validation Experiments: Design experiments specifically to address contradictions using multiple complementary techniques on the same biological samples .

When analyzing contradictory literature, researchers should avoid confirmation bias by systematically evaluating all available evidence rather than selectively focusing on studies supporting a particular hypothesis .

What techniques are available for studying sre-33 receptor dynamics and trafficking?

Advanced techniques for studying sre-33 dynamics and trafficking include:

  • Live-Cell Imaging Approaches:

    • FRAP (Fluorescence Recovery After Photobleaching) for lateral mobility assessment

    • Single-particle tracking with quantum dots for real-time receptor movement

    • PALM/STORM super-resolution microscopy for nanoscale localization patterns

  • Receptor Internalization Assays:

    • Antibody feeding assays with differential labeling of surface vs. internalized receptors

    • pH-sensitive fluorophores to distinguish surface from internalized populations

    • Biotinylation protection assays for quantitative internalization measurement

  • Intracellular Trafficking Visualization:

    • Multi-color confocal microscopy with organelle markers

    • RUSH system (Retention Using Selective Hooks) for synchronized trafficking studies

    • Correlative light and electron microscopy for ultrastructural context

  • Computational Approaches:

    • Machine learning algorithms for automatic tracking and classification of trafficking events

    • Quantitative image analysis pipelines for high-content screening approaches

These techniques should be applied in both basal and stimulated conditions to capture constitutive and ligand-induced trafficking dynamics. The experimental design should include appropriate controls for photobleaching, phototoxicity, and expression level variability .

How do post-translational modifications affect sre-33 function and signaling?

Post-translational modifications (PTMs) of sre-33 represent critical regulatory mechanisms that can fundamentally alter receptor function, localization, and signaling capabilities:

  • Phosphorylation Analysis:

    • Mass spectrometry-based phosphoproteomic mapping of modification sites

    • Phosphomimetic (S/T→D/E) and phosphodeficient (S/T→A) mutations to assess functional impacts

    • Kinase inhibition studies to identify regulatory enzymes

  • Ubiquitination Studies:

    • Similar to IL-33R regulation by USP38, sre-33 may undergo K27-linked polyubiquitination

    • Site-directed mutagenesis of potential ubiquitination sites (lysine residues)

    • Co-immunoprecipitation with ubiquitin mutants containing single lysine residues to identify linkage types

  • Glycosylation Analysis:

    • Enzymatic deglycosylation (PNGase F, Endo H) to assess N-linked glycan contributions

    • Site-directed mutagenesis of potential N-glycosylation sites (N-X-S/T motifs)

    • Lectin binding assays to characterize glycan structures

  • Lipid Modifications:

    • Palmitoylation studies using hydroxylamine sensitivity and click chemistry approaches

    • Acyl-biotin exchange assays to quantify dynamic palmitoylation

Similar to IL-33R studies, researchers should consider that modifications like ubiquitination might control receptor stability through autophagic degradation pathways . Experimental designs should account for the potential reciprocal regulation by deubiquitinases (like USP38) and ubiquitin ligases (like TRAF6) to establish a complete model of receptor regulation .

What approaches are effective for identifying interaction partners of sre-33?

Identifying sre-33 interaction partners requires complementary approaches that capture both stable and transient interactions:

  • Affinity-Based Methods:

    • Co-immunoprecipitation with epitope-tagged sre-33

    • Tandem affinity purification for high-stringency interaction mapping

    • Proximity-dependent biotin labeling (BioID, TurboID) for capturing transient interactions

    • APEX2-based proximity labeling for subcellular compartment-specific interactomes

  • Genetic Interaction Screens:

    • CRISPR-based genetic screens to identify synthetic lethal/sick interactions

    • Suppressor/enhancer screens in model organisms to identify functional relationships

  • Biophysical Interaction Measurements:

    • Surface plasmon resonance for kinetic and affinity measurements

    • Microscale thermophoresis for interactions in solution

    • Isothermal titration calorimetry for thermodynamic parameters

  • Computational Approaches:

    • Molecular docking simulations to predict binding interfaces

    • Evolutionary coupling analysis to identify co-evolving residues

    • Network analysis to place sre-33 in broader signaling pathways

When analyzing protein-protein interactions, researchers should employ appropriate controls including reversed tag orientations, competitive binding assays, and domain deletion constructs to validate specificity .

How should researchers analyze complex datasets from sre-33 functional studies?

Complex sre-33 datasets require sophisticated analytical approaches:

  • Multivariate Analysis Techniques:

    • Principal Component Analysis (PCA) to identify major sources of variation

    • Partial Least Squares Discriminant Analysis (PLS-DA) for identifying separating variables between experimental groups

    • Hierarchical clustering to identify patterns in signaling responses

  • Time-Series Analysis:

    • Dynamic time warping for comparing temporal signaling profiles

    • Fourier transformation to identify oscillatory patterns

    • Hidden Markov Models to detect state transitions in receptor activation

  • Dose-Response Relationship Analysis:

    • Non-linear regression with appropriate models (four-parameter logistic, operational model)

    • Calculation of potency (EC50) and efficacy (Emax) parameters

    • Bias factor calculations for comparing pathway selectivity

  • Statistical Considerations:

    • Correction for multiple comparisons (Benjamini-Hochberg, Bonferroni)

    • Mixed-effects models to account for batch and biological variability

    • Power analysis for determining adequate sample sizes

For comprehensive data interpretation, researchers should integrate results across different experimental modalities and compare findings with related receptors to identify conserved and divergent features .

What are the best practices for reproducibility in sre-33 research?

Ensuring reproducibility in sre-33 research requires systematic implementation of best practices:

  • Experimental Design Principles:

    • Pre-registration of study designs and analysis plans

    • Rigorous randomization and blinding procedures

    • Sample size determination through power analysis

    • Inclusion of all appropriate controls

  • Method Documentation:

    • Detailed reporting of receptor constructs (provide full sequence)

    • Comprehensive description of expression conditions

    • Step-by-step protocols with all buffer compositions

    • Equipment specifications and calibration details

  • Data Management:

    • Raw data preservation and availability

    • Structured metadata capture for all experiments

    • Version control for analysis scripts and software

    • Data visualization that accurately represents statistical significance

  • Validation Approaches:

    • Independent replication in different laboratories

    • Use of multiple complementary techniques to address the same question

    • Cross-validation across different experimental models

    • Transparent reporting of negative or contradictory results

These practices help mitigate the risk of both self-contradictions within studies and pairwise contradictions between studies, establishing a more coherent and reliable knowledge base for sre-33 research .

How can cryo-EM contribute to understanding sre-33 structure and function?

Cryo-electron microscopy (cryo-EM) offers transformative opportunities for sre-33 structural biology:

  • Sample Preparation Approaches:

    • Detergent-solubilized receptor preparation

    • Nanodisc reconstitution for lipid environment preservation

    • Antibody fragment (Fab) co-complexation for particle size enhancement

    • GLP-1 fusion proteins to improve particle orientation distribution

  • Data Collection Strategies:

    • Motion correction protocols to minimize beam-induced movement

    • Dose fractionation to balance resolution and radiation damage

    • Tilt series collection for addressing preferred orientation issues

    • Phase plate utilization for enhancing low-resolution features

  • Computational Processing Pipelines:

    • 2D and 3D classification to identify homogeneous particle populations

    • Focused refinement on flexible domains

    • Multi-body refinement for capturing conformational heterogeneity

    • Local resolution estimation and B-factor sharpening

  • Functional Integration:

    • Structure determination in multiple activation states

    • Molecular dynamics simulations based on cryo-EM models

    • Structure-guided mutagenesis to validate functional hypotheses

The insights gained from cryo-EM structures can guide rational design of tools for sre-33 research, including conformation-specific antibodies, improved ligands, and novel pharmacological modulators .

What computational approaches can predict ligand binding to sre-33?

Advanced computational methods offer powerful approaches for predicting sre-33-ligand interactions:

  • Homology Modeling Techniques:

    • Template selection based on evolutionary relationships

    • Model refinement using molecular dynamics simulations

    • Validation through experimental cross-linking constraints

    • Ensemble modeling to capture conformational diversity

  • Ligand Docking Approaches:

    • Rigid receptor versus induced-fit docking protocols

    • Fragment-based docking for novel ligand discovery

    • Consensus scoring across multiple algorithms

    • Integration of experimental mutagenesis data as constraints

  • Machine Learning Applications:

    • Deep learning models trained on known GPCR-ligand interactions

    • Feature extraction from protein sequences and known ligands

    • Transfer learning from related receptors with experimental data

    • Uncertainty quantification in binding predictions

  • Molecular Dynamics Simulations:

    • Free energy calculations for binding affinity estimation

    • Markov State Models to map conformational landscape

    • Enhanced sampling techniques to overcome energy barriers

    • Coarse-grained approaches for extended timescale phenomena

These computational approaches should be validated through experimental testing of predicted interactions, creating an iterative cycle of computational prediction and experimental verification .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.