Recombinant Serpentine receptor class epsilon-8 (sre-8)

Shipped with Ice Packs
In Stock

Description

Introduction to Serpentine Receptor Class Epsilon-8 (sre-8)

Serpentine receptor class epsilon-8 (sre-8) is a member of the larger family of G protein-coupled receptors (GPCRs) found in the nematode Caenorhabditis elegans. The protein is encoded by the sre-8 gene, which is also known by its alternate designation F40G12.1 . The sre-8 protein has been assigned the UniProt identification number Q20249, which serves as the definitive reference point for this protein in international databases . Serpentine receptors are characterized by their distinctive structure featuring seven transmembrane domains that snake through the cell membrane, creating a receptor capable of detecting external signals and transducing them into intracellular responses. The epsilon class of serpentine receptors represents one of several subfamilies within the larger serpentine receptor superfamily in C. elegans, which collectively play crucial roles in chemosensation, development, and other physiological processes.

The study of sre-8 contributes to our broader understanding of receptor-mediated processes in multicellular organisms. Unlike some highly conserved proteins, serpentine receptors often show considerable diversity across species, reflecting their adaptation to specific environmental and physiological requirements of different organisms. The recombinant production of sre-8 protein has enabled more detailed structural and functional studies that were previously hindered by the difficulties in isolating sufficient quantities of the native protein from C. elegans. By expressing the full-length protein with affinity tags such as histidine (His), researchers can now obtain purified sre-8 for a variety of experimental applications, including structural studies, binding assays, and antibody production .

Expression and Purification of Recombinant sre-8

The recombinant full-length Serpentine receptor class epsilon-8 protein is typically expressed in Escherichia coli expression systems, which offer several advantages for protein production . The bacterial expression system allows for rapid growth, high protein yields, and cost-effective production compared to eukaryotic expression systems. For the production of sre-8, the protein coding sequence is cloned into a suitable expression vector that includes sequences encoding an N-terminal histidine tag for purification purposes. The expression construct is then transformed into E. coli host cells, which are cultured under controlled conditions to optimize protein expression. Induction of protein expression is typically achieved using chemical inducers such as isopropyl β-d-1-thiogalactopyranoside (IPTG), which activates the promoter controlling the sre-8 gene in the expression vector.

Following expression, the recombinant sre-8 protein must be isolated and purified to a high degree for research applications. The purification process typically begins with cell lysis to release the intracellular proteins, followed by a series of chromatographic steps to isolate the target protein. The presence of the histidine tag on the recombinant sre-8 allows for efficient purification using immobilized metal affinity chromatography (IMAC), where the tagged protein selectively binds to metal ions (typically nickel or cobalt) immobilized on a resin . After binding, contaminants are washed away, and the purified sre-8 protein is eluted using buffers containing imidazole or changes in pH. Additional purification steps may include size exclusion chromatography or ion exchange chromatography to achieve the high level of purity (>90%) typically required for research applications.

Research Applications

Recombinant Serpentine receptor class epsilon-8 (sre-8) protein serves as a valuable research tool in multiple applications across molecular biology, biochemistry, and cell biology fields. One primary application is in structural studies, where the purified protein can be used for crystallography, nuclear magnetic resonance (NMR) spectroscopy, or cryo-electron microscopy to determine its three-dimensional structure. Such structural information is crucial for understanding the protein's function and mechanism of action, as well as for rational drug design targeting this or related receptors. The recombinant protein can also be employed in binding assays to identify natural ligands or synthetic compounds that interact with sre-8, providing insights into its physiological role and potential pharmaceutical applications. Additionally, the protein can be used as a substrate in enzymatic assays to study post-translational modifications or as an antigen for antibody production.

The development of antibodies against sre-8 represents another significant application of the recombinant protein. By using the purified recombinant sre-8 as an immunogen, researchers have successfully produced polyclonal antibodies in rabbits that specifically recognize this protein . These antibodies have been purified using antigen affinity methods to ensure high specificity and have applications in various immunological techniques. Western blotting (WB) and enzyme-linked immunosorbent assay (ELISA) are two commonly cited applications for these antibodies, allowing researchers to detect and quantify sre-8 in various experimental contexts . The availability of such specific antibodies facilitates research into the expression patterns, localization, and potential interactions of sre-8 in C. elegans, contributing to our understanding of its biological functions.

The study of sre-8 in C. elegans also has broader implications for understanding serpentine receptors and G protein-coupled signaling in other organisms. While information on the specific functional role of sre-8 is somewhat limited in the available search results, the conservation of serpentine receptors across multicellular organisms suggests potential parallels with similar receptors in other species. Research using recombinant sre-8 and related tools can contribute to our understanding of receptor-mediated endocytosis, a fundamental cellular process by which cells internalize extracellular materials and signaling molecules . The insights gained from studying sre-8 in the model organism C. elegans can potentially inform research on related receptors in mammals, including humans, with implications for physiology, pathology, and drug development.

Available Research Tools

A variety of research tools have been developed to facilitate the study of Serpentine receptor class epsilon-8 (sre-8), expanding the methodological options available to researchers investigating this protein. Foremost among these tools is the commercially available recombinant full-length sre-8 protein, which is produced with an N-terminal histidine tag and expressed in E. coli . This purified protein serves as the foundation for many experimental approaches, providing a reliable source of the target molecule for in vitro studies. The recombinant protein is typically available in a highly purified form (>90% purity) and can be reconstituted according to the manufacturer's recommendations for various applications. The consistency and purity of commercially produced recombinant sre-8 protein help ensure reproducibility across experiments and between different research groups, contributing to the robustness of scientific findings in this area.

Complementing the recombinant protein are specific antibodies developed against sre-8, which enable detection and localization studies. Polyclonal antibodies raised in rabbits against recombinant C. elegans sre-8 protein are commercially available and have been validated for applications such as ELISA and Western blotting . These antibodies are typically purified using antigen affinity methods to enhance specificity and reduce background reactivity. The availability of such antibodies expands the toolbox for researchers, allowing for studies of protein expression, tissue distribution, and potential changes under various experimental conditions. When used in combination with appropriate controls and validation steps, these antibodies can provide valuable insights into the biology of sre-8 in its native context.

In addition to protein and antibody reagents, molecular biology tools such as gene constructs, vectors, and primers for sre-8 may be available through commercial sources or academic repositories, though specific details on these resources were not prominent in the search results. For researchers working with C. elegans as a model organism, techniques such as RNA interference (RNAi) and CRISPR-Cas9 gene editing could potentially be applied to study the function of sre-8 through loss-of-function or gain-of-function approaches. The combination of recombinant proteins, specific antibodies, and molecular genetic tools creates a comprehensive research platform for investigating the structure, function, and biological significance of sre-8 in C. elegans, with potential implications for understanding related proteins in other organisms.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For working aliquots, store at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
sre-8; F40G12.1; Serpentine receptor class epsilon-8; Protein sre-8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-341
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
sre-8
Target Protein Sequence
MCSPSTSDVRFITFVNTTYIEAEGLEAIFDLLLKIEVGFLVFSWIEFLYLFYLFIFIRSM HFNLTFLFMNYGGQYFCSMLSRCIIVYQQLGNDPNNDLHNWILVANFARTVCLFIAMYIL PIFMIERCLASFFVKNYEKSRKIWVSLMILSIFHPLVFASAIAYIQCWIPVVVHVISFFI VNIIGYIGIHICYSYNIKKHRKFYSPQCISRVTYGLSERFQLAENIKMCKVLKKVQISIL FFNIGCCSILLMDHFQVKMMIIYWSYVCFNFFALVYGITVPIILYSALPEWQKETRRLLN LCIGRRNVGEEPKSTFGEQMIYNDHAIESNIYFTQFNKTTH
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_F40G12.1

UniGene: Cel.3639

Protein Families
Nematode receptor-like protein sre family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Serpentine receptor class epsilon-8 (sre-8)?

Recombinant Serpentine receptor class epsilon-8 (sre-8) is a protein found in Caenorhabditis elegans, classified as a serpentine receptor. The full protein consists of 341 amino acids and is encoded by the gene sre-8 (ORF designation: F40G12.1) with UniProt accession number Q20249 . Serpentine receptors are characterized by their seven-transmembrane structure and typically function as G protein-coupled receptors involved in sensory perception and signal transduction pathways. The recombinant form of sre-8 is artificially produced for research purposes to study its structure, function, and interactions in laboratory settings . This receptor belongs to a larger family of chemosensory receptors that enable C. elegans to detect and respond to environmental chemical cues.

What are the optimal storage conditions for recombinant sre-8 protein?

For optimal stability and experimental reproducibility, recombinant sre-8 protein should be stored at -20°C in a Tris-based buffer containing 50% glycerol that has been optimized specifically for this protein . For extended storage periods, conservation at -80°C is recommended to prevent degradation . Working aliquots can be stored at 4°C for up to one week to minimize freeze-thaw cycles . It is particularly important to note that repeated freezing and thawing is not recommended as this can compromise protein integrity and experimental outcomes . Researchers should prepare small working aliquots during initial thawing to minimize the need for multiple freeze-thaw cycles, which can cause protein denaturation and aggregation. This storage protocol helps maintain the protein's structural integrity and biological activity for consistent experimental results.

What expression systems are commonly used to produce recombinant sre-8?

While the search results don't specifically mention expression systems for sre-8, recombinant proteins from C. elegans are typically produced using several established expression platforms. The choice of expression system depends on research requirements including post-translational modifications, protein folding, and yield considerations. Common expression systems include:

Expression SystemAdvantagesLimitationsRecommended for sre-8
E. coliHigh yield, cost-effective, rapid productionLimited post-translational modifications, potential folding issuesInitial structural studies, antibody production
Insect cellsBetter protein folding, some post-translational modificationsMore complex, moderate yieldFunctional studies requiring proper folding
Mammalian cellsMost complete post-translational modifications, proper foldingExpensive, lower yieldInteraction studies, signaling assays
Yeast systemsGood compromise of yield and modificationsSpecies-specific glycosylationLarge-scale production for biochemical characterization

For studying membrane proteins like serpentine receptors, insect cell or mammalian cell expression systems are often preferred due to their ability to properly fold transmembrane domains and provide appropriate post-translational modifications. When selecting an expression system, researchers should consider the specific experimental requirements and downstream applications.

How should I design experiments to study sre-8 function in C. elegans?

When designing experiments to study sre-8 function in C. elegans, a systematic approach following sound experimental design principles is essential. Begin by clearly defining your independent variables (e.g., genetic manipulations of sre-8, environmental conditions) and dependent variables (e.g., behavioral responses, gene expression changes, protein interactions) . Formulate specific, testable hypotheses about sre-8 function based on its classification as a serpentine receptor . For genetic studies, design appropriate control and experimental groups, considering both between-subjects designs (comparing different worm populations) and within-subjects designs (measuring the same worms under different conditions) .

To study sre-8's function in neural signaling, implement techniques such as:

  • CRISPR/Cas9 gene editing to create loss-of-function mutants or fluorescent protein fusions

  • Cell-specific rescue experiments to confirm neuronal functions

  • Calcium imaging to monitor neural activity in response to stimuli

  • Behavioral assays to assess phenotypic effects of sre-8 manipulation

What molecular techniques are most effective for studying sre-8 expression patterns?

For comprehensive characterization of sre-8 expression patterns, a multi-method approach yields the most reliable results. Based on current research methodologies, these techniques are particularly effective:

  • Single-nucleus RNA sequencing (snSeq): This approach provides cell-type-specific expression data with high resolution, allowing identification of neuron-specific expression patterns of sre-8 . snSeq can reveal differential expression across developmental stages or in response to genetic manipulations.

  • Fluorescent reporter constructs: Creating transgenic C. elegans with sre-8 promoter::GFP fusion constructs enables visualization of spatial and temporal expression patterns. Similar to the approaches used for other neuropeptide genes like nlp-12, fluorescence intensity can be quantified to assess expression level differences between wild-type and mutant backgrounds .

  • RNA in situ hybridization: This technique localizes sre-8 mRNA in fixed tissue samples, complementing reporter gene approaches and providing direct evidence of transcript presence.

  • Immunohistochemistry: If antibodies against sre-8 are available, this method reveals protein localization at subcellular resolution, which is particularly valuable for membrane proteins like serpentine receptors.

For optimal results, combine multiple techniques to cross-validate findings. For instance, while reporter constructs are relatively straightforward to implement, they may not capture all regulatory elements, whereas snSeq provides comprehensive expression data but lacks spatial resolution without additional analysis. When reporting results, quantify expression levels using appropriate statistical methods and present comparative data in well-structured tables or graphs.

How can I assess potential interactions between sre-8 and neuropeptide signaling pathways?

To thoroughly assess interactions between sre-8 and neuropeptide signaling pathways, implement a systematic multi-level approach that examines both physical and functional interactions. Begin by identifying potential neuropeptide ligands that might interact with sre-8 based on expression pattern overlaps in neuronal populations . Similar to the approaches described for nlp-58/tkr-2 and nlp-12/ckr-1 systems, map the neuronal expression of sre-8 and compare it with neuropeptide expression patterns to identify candidate interactions .

For functional validation, employ these methodological approaches:

  • In vitro binding assays: Test direct binding between purified recombinant sre-8 and candidate neuropeptides using techniques such as surface plasmon resonance or fluorescence polarization.

  • Calcium imaging: In transgenic worms expressing calcium indicators in sre-8-expressing neurons, apply synthetic neuropeptides and monitor calcium flux responses.

  • Genetic interaction studies: Generate double mutants of sre-8 and candidate neuropeptide genes, then assess phenotypes for evidence of genetic interactions, such as enhancement or suppression of single mutant phenotypes.

  • Transcriptional profiling: Use snSeq to compare transcriptional changes in sre-8-expressing neurons in wild-type versus neuropeptide-deficient backgrounds .

  • Behavioral assays: Implement quantitative behavioral assays to measure functional outcomes of disrupting both sre-8 and neuropeptide signaling compared to single pathway disruptions.

Document all interactions systematically, noting both positive and negative results to build a comprehensive interaction map. This approach can reveal whether sre-8 functions within known neuropeptidergic networks or constitutes a novel signaling pathway that operates independently of the established synaptic connectome, similar to other extrasynaptic signaling pairs identified in C. elegans .

How does sre-8 expression change in response to insulin signaling pathway modifications?

The relationship between sre-8 and insulin signaling appears to involve complex regulatory mechanisms. Evidence from research on related serpentine receptors suggests that insulin signaling can significantly modulate gene expression in neurons, including serpentine receptors . Specifically, serpentine receptor srm-1 has been identified as part of an interaction network with daf-2 (the C. elegans insulin receptor homolog) and several insulin-like peptide genes (ins-6, ins-9, ins-24) . This suggests that serpentine receptors like sre-8 may be regulated by insulin signaling pathways.

When analyzing expression changes, researchers should consider both transcriptional and post-transcriptional regulation. Single-nucleus sequencing (snSeq) approaches reveal that some genes show consistent differential expression across many neurons in daf-2 mutants, while others show highly neuron-specific differential expression patterns . For sre-8, this neuron-specific analysis is crucial, as global expression changes might mask important cell-type-specific regulations.

To properly investigate sre-8 expression changes in response to insulin signaling modifications:

  • Generate transgenic animals expressing fluorescent reporters driven by the sre-8 promoter in both wild-type and daf-2 mutant backgrounds

  • Implement quantitative PCR to measure transcript levels across different genetic backgrounds

  • Use snSeq to identify neuron-specific expression changes in daf-2, daf-16, or age-1 mutants compared to wild-type

  • Perform time-course analyses to distinguish immediate versus long-term effects of insulin signaling disruption

Creating a comprehensive expression profile across multiple insulin pathway mutants would provide insights into how sre-8 integrates into broader signaling networks regulating neuronal function and possibly lifespan.

What roles might sre-8 play in neuronal communication beyond traditional synaptic signaling?

Recombinant Serpentine receptor class epsilon-8 (sre-8) likely participates in extrasynaptic neuronal communication through neuropeptide-mediated signaling networks that function independently of or in parallel to the canonical synaptic connectome. Recent research has revealed that neuropeptide-receptor pairs can facilitate communication between neurons that lack direct synaptic connections, establishing a "wireless" signaling network . This type of signaling allows for broader integration of neuronal information beyond the constraints of physical synaptic connections.

Similar to identified neuropeptide-receptor pairs like NLP-58/TKR-1/TKR-2 and NLP-12/CKR-1, sre-8 may function as a receptor for diffusible neuropeptide signals, enabling long-range neuronal communication . This hypothesis is supported by findings that neuropeptide signaling creates functional connections between neurons that are not physically connected through chemical synapses or gap junctions .

To investigate sre-8's role in extrasynaptic signaling, researchers should:

  • Map the expression pattern of sre-8 across the complete set of C. elegans neurons using snSeq approaches

  • Identify potential neuropeptide ligands through binding assays and genetic interaction studies

  • Analyze the spatial relationship between sre-8-expressing neurons and neurons expressing candidate ligands

  • Examine whether sre-8-mediated signaling persists in mutants with disrupted synaptic transmission

The significance of such extrasynaptic signaling extends to understanding how neural circuits integrate information across diverse time scales and spatial domains, potentially explaining complex behaviors that cannot be accounted for by the synaptic connectome alone. This research direction represents an important frontier in understanding the full complexity of neuronal communication systems.

How does post-translational modification affect sre-8 function and localization?

Post-translational modifications (PTMs) likely play crucial roles in regulating sre-8 function, trafficking, and signaling capabilities. While specific information about sre-8 PTMs is not directly provided in the search results, research on serpentine receptors and G protein-coupled receptors (GPCRs) more broadly indicates several key modification types that would be relevant to investigate:

Modification TypeFunctional ImpactExperimental Approaches
PhosphorylationRegulates receptor desensitization, internalization, and signaling biasPhospho-specific antibodies, mass spectrometry, site-directed mutagenesis
GlycosylationInfluences membrane trafficking, ligand binding, and protein stabilityGlycosidase treatments, glycosylation site mutations, lectin binding assays
PalmitoylationAffects membrane microdomain localization and signaling complex formationClick chemistry-based detection, acyl-biotin exchange assays
UbiquitinationControls receptor degradation and recycling pathwaysUbiquitin pulldown assays, proteasome inhibitor studies

To investigate how these modifications affect sre-8:

  • Generate fluorescently tagged sre-8 constructs with mutations at predicted modification sites

  • Analyze subcellular localization changes using high-resolution microscopy

  • Assess functional consequences of modification site mutations through calcium imaging or behavioral assays

  • Identify interacting proteins that differ between modified and unmodified receptor states

Additionally, it's important to investigate whether insulin signaling pathways, which have been shown to regulate serpentine receptor expression , also influence sre-8 post-translational modifications. Environmental conditions like temperature or food availability might also alter the PTM profile of sre-8, potentially representing an adaptive mechanism for modulating chemosensory responses under different conditions. The technical challenge of studying PTMs in specific neurons can be addressed using cell-type-specific biochemical approaches or proximity labeling methods.

What statistical approaches are most appropriate for analyzing sre-8 expression data?

When analyzing sre-8 expression data, researchers should employ statistical methods that account for the specific characteristics of the experimental design and data type. For single-nucleus RNA sequencing (snSeq) data, which provides high-resolution expression information across individual neurons, specialized statistical approaches are necessary . The following methodological framework is recommended:

  • Data normalization: Apply appropriate normalization methods to account for technical variability between samples, including total count normalization, quantile normalization, or more sophisticated approaches like SCTransform for single-cell data.

  • Differential expression analysis: For comparing sre-8 expression between experimental conditions (e.g., wild-type vs. daf-2 mutants), use statistical frameworks specifically designed for RNA-seq data, such as:

    • DESeq2 or edgeR for bulk sequencing data

    • MAST, zinbwave, or scDD for single-cell or single-nucleus data

    • Linear mixed models when accounting for both fixed and random effects

  • Network analysis: To understand co-regulation patterns, implement gene network analysis using tree-based ensemble methods like GENIE3, which can calculate regulatory strength between genes, similar to approaches used for analyzing daf-2 differential expression networks .

  • Dimensionality reduction: For visualizing complex expression relationships, employ techniques such as principal component analysis (PCA), t-SNE, or UMAP.

  • Cell-type specific analysis: Since sre-8 may show neuron-specific expression patterns, implement statistical approaches that can detect significant changes in small subsets of cells, such as MAST with a hurdle model.

When reporting results, clearly document all statistical parameters including sample sizes, significance thresholds, and corrections for multiple testing. For visualization, create comprehensive figures that display both the statistical significance and magnitude of expression changes across different neuronal populations. This approach ensures robust interpretation of sre-8 expression patterns and their biological significance.

How can I interpret contradictory results in sre-8 functional studies?

Contradictory results in sre-8 functional studies may arise from multiple sources, including differences in experimental design, genetic background variations, or context-dependent receptor functions. To effectively interpret and reconcile such contradictions, implement a systematic analytical approach:

  • Cross-experimental comparison matrix: Create a detailed comparison table documenting key methodological differences between studies, including:

    • Genetic backgrounds and strain differences

    • Environmental conditions (temperature, media composition)

    • Developmental stages examined

    • Expression system variations for recombinant protein studies

    • Assay sensitivity and specificity parameters

  • Cell-type specific resolution: Contradictions may result from analyzing different neuronal subpopulations. Single-nucleus sequencing approaches reveal that some genes exhibit neuron-specific differential expression patterns . Therefore, analyze whether contradictory results might reflect genuine biological differences across neuronal subtypes rather than experimental inconsistencies.

  • Integration of multiple data types: Combine evidence from complementary methodologies, such as:

    • Genetic (mutant phenotypes, rescue experiments)

    • Biochemical (protein interactions, modifications)

    • Physiological (calcium imaging, electrophysiology)

    • Behavioral (quantitative assays of relevant behaviors)

  • Bayesian synthesis framework: When faced with contradictory data, implement a Bayesian approach that weighs evidence based on methodological strength and replication robustness, rather than treating all results equally.

  • Alternative hypothesis development: Consider whether contradictions might reveal novel aspects of sre-8 biology, such as:

    • Context-dependent signaling mechanisms

    • Developmental regulation changes

    • Functional redundancy with related receptors

    • Biased signaling depending on ligand or cellular environment

Document both positive and negative results thoroughly in publications to provide a comprehensive view of sre-8 function and avoid publication bias toward positive findings. This transparent approach accelerates field progress by preventing repetition of unproductive experimental directions and highlighting genuine biological complexity.

What emerging technologies could advance our understanding of sre-8 function?

Several cutting-edge technologies show particular promise for elucidating sre-8 function in neural circuits and cellular signaling pathways:

  • Cryo-electron microscopy (Cryo-EM): This technique could reveal the three-dimensional structure of sre-8, providing insights into ligand binding sites and conformational changes. Understanding the structural basis of sre-8 function would enable rational design of specific activators or inhibitors for functional studies.

  • Optogenetic and chemogenetic tools: Developing optogenetic modulators of sre-8 activity would allow temporally precise control of receptor function in specific neurons. Similarly, chemogenetic approaches like DREADD (Designer Receptors Exclusively Activated by Designer Drugs) could be adapted for sre-8 to enable inducible receptor activation.

  • Spatial transcriptomics: Technologies like Slide-seq or MERFISH would allow mapping of sre-8 expression within the context of intact neural tissues, preserving spatial relationships that are lost in dissociated single-nucleus approaches .

  • Bioluminescence resonance energy transfer (BRET): For studying protein-protein interactions involving sre-8 in living cells, BRET offers advantages over traditional biochemical approaches by detecting dynamic interactions in real-time.

  • CRISPR-based lineage tracing: Combining CRISPR editing with single-cell genomics would allow tracking of how sre-8-expressing cells develop and differentiate, potentially revealing developmental roles for this receptor.

  • Nanobody-based sensors: Developing conformational sensors using nanobodies could report on sre-8 activation states in vivo, providing insights into when and where the receptor is engaged by its ligands.

  • Artificial intelligence for behavioral analysis: Machine learning approaches could identify subtle behavioral phenotypes in sre-8 mutants that escape detection by conventional assays, revealing previously unrecognized functions.

These technologies, particularly when combined in integrated research programs, have the potential to dramatically advance our understanding of sre-8 biology beyond what conventional approaches have revealed to date.

How might understanding sre-8 contribute to broader knowledge of neural circuit function?

Investigating Recombinant Serpentine receptor class epsilon-8 (sre-8) has significant potential to advance our understanding of neural circuit function in several fundamental aspects. As a serpentine receptor likely involved in chemosensory processing and potentially extrasynaptic signaling, sre-8 research can illuminate how neural circuits process information beyond traditional synaptic networks.

Recent discoveries about neuropeptide-receptor interactions independent of the connectome suggest that serpentine receptors like sre-8 may participate in a "wireless" signaling network that operates alongside hardwired synaptic connections . This parallel signaling system could explain how neural circuits achieve greater functional complexity than predicted by their anatomical connectivity alone. By mapping sre-8's role in this extrasynaptic network, researchers could reveal fundamental principles about information processing in neural systems more broadly.

Furthermore, understanding how sre-8 expression and function are modulated by insulin signaling pathways may reveal mechanisms by which metabolic state influences neural circuit function . This intersection between metabolism and neural processing represents a critical frontier in neuroscience with implications for understanding how organisms adapt their behavior to changing environmental conditions.

Since serpentine receptors are expressed across diverse neuronal subtypes, characterizing sre-8's cell-type specific functions could also provide insights into how the same molecular machinery can serve different functional roles depending on cellular context. The single-nucleus transcriptomic approaches revealing neuron-specific gene expression patterns offer unprecedented resolution for understanding this context-dependence .

Additionally, C. elegans provides an exceptional model system where findings about sre-8 can be integrated with complete connectome data, behavioral outcomes, and genetic manipulations—a level of system-wide analysis not yet possible in more complex organisms. Insights from this integrated analysis could generate principles applicable to understanding neural circuits across species.

What are the key methodological considerations when designing experiments with recombinant sre-8?

When designing experiments with recombinant Serpentine receptor class epsilon-8 (sre-8), researchers should implement a comprehensive methodological framework that addresses multiple technical challenges. First, protein stability and functionality must be carefully maintained through appropriate storage conditions (-20°C or -80°C for extended storage) and buffer composition (Tris-based buffer with 50% glycerol) . Working aliquots should be stored at 4°C for no more than one week, and repeated freeze-thaw cycles must be strictly avoided to prevent protein degradation .

For functional studies, consider the following methodological priorities:

  • Validation of protein folding and activity: Before conducting experiments, verify that the recombinant sre-8 maintains its native conformation using techniques such as circular dichroism or limited proteolysis. Develop activity assays based on predicted G-protein coupling to confirm functionality.

  • Experimental controls: Include both positive controls (known functional serpentine receptors) and negative controls (denatured protein, buffer-only) in all experimental designs to distinguish specific from non-specific effects.

  • Concentration optimization: Titrate recombinant sre-8 concentrations to identify the physiologically relevant range for your specific experimental system, avoiding artifacts from excessive protein levels.

  • Complementary in vivo approaches: Validate in vitro findings using genetic approaches in C. elegans, such as rescue experiments expressing the recombinant protein in sre-8 mutant backgrounds.

  • Tag interference assessment: If the recombinant protein includes affinity tags, conduct parallel experiments with differently tagged versions or cleaved protein to verify that the tag does not interfere with function.

When designing experimental protocols, explicitly document all relevant parameters including protein concentration, buffer composition, temperature, incubation times, and detection methods to ensure reproducibility. This comprehensive methodological approach will maximize the reliability and biological relevance of experiments using recombinant sre-8.

How can findings from sre-8 research be integrated into broader studies of C. elegans neurobiology?

Findings from sre-8 research can be strategically integrated into broader studies of C. elegans neurobiology through several methodological approaches that connect molecular mechanisms to system-level functions. First, incorporate sre-8 into existing frameworks of neuropeptide-receptor interactions by comparing its expression patterns with known neuropeptide distributions to identify potential signaling partnerships . This integration can reveal whether sre-8 participates in established signaling networks or constitutes part of a previously uncharacterized pathway.

Researchers should also contextualize sre-8 function within the insulin signaling network, given that serpentine receptors have been identified as components of insulin signaling interaction networks . This integration could reveal how sensory reception through serpentine receptors like sre-8 influences or is influenced by metabolic signaling pathways, potentially explaining how environmental cues modulate developmental decisions and lifespan.

From a technical perspective, integrate sre-8 analysis into multi-omic research approaches by:

  • Combining sre-8 expression data from snSeq with proteomic analyses to identify post-translational modifications and protein interaction networks

  • Correlating sre-8 activity with neuronal calcium imaging data to connect receptor activation to functional neural outputs

  • Mapping sre-8-dependent behaviors to specific neural circuits using targeted expression or silencing approaches

  • Utilizing gene network analysis methods like GENIE3 to position sre-8 within broader regulatory networks

When publishing findings, explicitly discuss how sre-8 research contributes to central questions in C. elegans neurobiology, such as sensory processing, neuromodulation, or developmental plasticity. This contextual framing ensures that molecular-level insights about sre-8 inform our understanding of how neural circuits function as integrated systems rather than collections of individual components.

What are the essential resources for researchers beginning work with sre-8?

For researchers initiating studies on Recombinant Serpentine receptor class epsilon-8 (sre-8), several essential resources provide foundational knowledge and practical tools. The UniProt database (entry Q20249) offers comprehensive protein information including sequence data, predicted domains, and known modifications . This database entry serves as the authoritative reference for sre-8's molecular characteristics. WormBase, the central repository for C. elegans genetics, provides gene expression data, phenotype information, and literature references specific to sre-8 (gene designation F40G12.1).

For obtaining recombinant sre-8 protein, commercial sources offer standardized preparations with detailed handling protocols . These commercial preparations typically include information on storage conditions (optimal at -20°C in Tris-based buffer with 50% glycerol, with extended storage at -80°C) , working concentration ranges, and quality control specifications. Working aliquots can be maintained at 4°C for up to one week to minimize freeze-thaw cycles .

For experimental design guidance, researchers should consult comprehensive guides on C. elegans neurobiology methods and experimental design principles . These resources outline approaches for defining variables, writing testable hypotheses, designing appropriate controls, and implementing proper statistical analyses .

To situate sre-8 within broader neuronal signaling networks, recent publications on single-nucleus RNA sequencing provide valuable insights into cell-type specific expression patterns and regulatory relationships . These studies offer methodological frameworks for analyzing sre-8 expression in specific neuronal populations and identifying potential signaling partners .

For functional characterization, resources on neuropeptide-receptor interaction mapping provide templates for investigating sre-8's potential role in extrasynaptic signaling . These approaches can help determine whether sre-8 participates in the "wireless" neuronal communication network that operates independently of the synaptic connectome .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.