Recombinant Serpentine receptor class gamma-11 (srg-11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
srg-11; T04A8.2; Serpentine receptor class gamma-11; Protein srg-11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
srg-11
Target Protein Sequence
MPSFRPNISNDLDTIIFECNSNYDTIVEVTKWFLQIAYLIPGGILNILLLYTILFKNSEI YASSSFFLIYSTDCFVSFSMIFLDIIGRTLVYFTPLCPIIAPMFYEPLIGFKIMMIVLHH SRACKSLIQILLVVNRMSCVIYPIRYGKMWMRPLKYLIILVFVIPFSIDWNLIISRVYMQ PTFGGIYMEYIKKVAWASQSRFQLIFITIALLFTIVCTSVIFYTLVMLPKRLRNVERTLS LGTAYISMSFIILVVFQFLFAFYSDIFTTSTIFGYSLLSYDILNVGSPIIMHCVSSKLRN HVLRGSRKLSSAARVVPVSNVTSTNGWVNLIVITL
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_T04A8.2

UniGene: Cel.23979

Protein Families
Nematode receptor-like protein srg family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Serpentine receptor class gamma-11 (srg-11) and how does it function in model organisms?

Serpentine receptor class gamma-11 (srg-11) belongs to the larger family of G protein-coupled receptors (GPCRs) found primarily in nematodes such as Caenorhabditis elegans. Similar to the well-studied serpentine receptor class alpha-11 (sra-11), which functions in olfactory imprinting and odorant response, srg-11 likely plays a role in chemosensation . While specific research on srg-11 is limited in the available literature, insights can be drawn from related receptors such as srg-36 and srg-37, which function as pheromone receptors in C. elegans . These receptors are typically expressed in chemosensory neurons and transduce external chemical signals into intracellular responses, allowing the organism to respond to environmental cues.

How is srg-11 classified within the broader serpentine receptor family?

Serpentine receptors in C. elegans are classified into several classes (including alpha, gamma, etc.) based on sequence homology and structural characteristics. The srg family (to which srg-11 belongs) is one of the larger subfamilies of serpentine receptors in nematodes. Classification systems are typically based on phylogenetic analysis of transmembrane domains and loop regions. For proper classification of a newly identified or studied srg-11 sequence, researchers should employ multiple sequence alignment with other known serpentine receptors, followed by phylogenetic tree construction using methods such as maximum likelihood or Bayesian inference. Comparison with well-characterized members like sra-11, which has been identified as requiring "olfactory imprinting a requisite in ordorant response such as benzaldehyde and isoamylalcohol," can help place srg-11 within the functional context of the broader receptor family .

What expression systems are most effective for producing recombinant srg-11 protein?

For recombinant expression of serpentine receptors like srg-11, cell-free expression systems have proven effective for transmembrane proteins. According to available product information for similar proteins, cell-free systems can maintain proper protein folding for transmembrane proteins that might otherwise form inclusion bodies in bacterial expression systems . Alternative approaches include:

  • Baculovirus-insect cell expression systems, which maintain post-translational modifications

  • Mammalian cell expression using HEK293 or CHO cells for proper folding and trafficking

  • Yeast expression systems (S. cerevisiae or P. pastoris) for higher yields

The choice depends on research goals—functional studies may require mammalian systems, while structural studies might benefit from higher yields in yeast or cell-free systems. When designing expression constructs, researchers should consider adding purification tags (His, FLAG, etc.) positioned to minimize interference with receptor function, and optimize codon usage for the selected expression system.

What are the recommended methods for functional characterization of recombinant srg-11?

Functional characterization of recombinant srg-11 can be approached using methods similar to those employed for related serpentine receptors:

  • Ligand binding assays: Using potential ligands labeled with fluorescent or radioactive markers to determine binding affinity and specificity.

  • Calcium mobilization assays: Measuring intracellular calcium release upon receptor activation using calcium-sensitive fluorescent dyes.

  • Genetic approaches in model organisms: Creating knockout or overexpression models in C. elegans using CRISPR/Cas9 or transgenic techniques to observe phenotypic changes.

  • Electrophysiological recordings: Measuring membrane potential changes in cells or neurons expressing srg-11 when exposed to potential ligands.

  • Behavioral assays: Analyzing chemotaxis, avoidance, or preference behaviors in mutant vs. wild-type nematodes to identify functional roles.

Since serpentine receptors like sra-11 are known to be "specifically required for olfactory imprinting" and function "in interneurons downstream of the sensory neuron class," similar methodological approaches would be applicable for characterizing srg-11 .

How can I identify potential srg-11 genes in non-model nematode species?

To identify srg-11 homologs in non-model nematode species, researchers can employ a combination of genomic approaches:

  • RAD sequencing approach: Restriction-site associated DNA (RAD) sequencing can effectively reduce genome complexity and allow for targeted discovery. This approach has been successfully applied to organisms without reference genomes and can be adapted for identifying serpentine receptor genes . The methodology involves:

    • Genomic DNA digestion with appropriate restriction enzymes (e.g., EcoRI)

    • Construction of multiplexed sequencing libraries

    • Illumina sequencing (101-bp single-end reads recommended)

    • Sequence analysis using USTACKS for clustering reads into RAD-tags

    • SNP calling and comparative analysis between species/strains

  • Comparative genomic approach: Using known sequences of srg-11 or related receptors from model organisms as query sequences in BLAST searches against genomic or transcriptomic data from target species.

  • PCR-based approach: Designing degenerate primers based on conserved regions of serpentine receptors for amplification and sequencing of potential srg-11 genes, followed by cloning using inverse PCR (IPCR) to capture complete genes, as demonstrated for other genetic targets .

For validation of identified sequences, phylogenetic analysis comparing the candidate genes with known serpentine receptors is essential to confirm proper classification within the srg family.

What SNP analysis methods are most appropriate for studying srg-11 genetic variants?

For analyzing SNPs in srg-11 genes, researchers can employ methodologies similar to those used in study for laying-related SNP discovery:

A well-designed SNP analysis workflow for srg-11 would include:

  • Initial SNP discovery through pooled sequencing

  • Selection of candidate SNPs based on statistical significance

  • Validation in larger populations using cost-effective genotyping methods

  • Functional analysis of validated SNPs through expression studies or in vivo models

How do mutations in srg-11 affect chemosensory behavior in C. elegans?

While specific information about srg-11 mutations is not directly available in the search results, insights can be drawn from studies of related serpentine receptors. Based on the information about sra-11 and other serpentine receptors in C. elegans, researchers investigating srg-11 mutations should consider:

  • Behavioral assays:

    • Chemotaxis assays to test attraction or repulsion to specific chemicals

    • Olfactory adaptation tests to assess sensory processing

    • Olfactory imprinting experiments, as sra-11 is specifically required for this process

  • Neuronal imaging:

    • Calcium imaging of sensory neurons expressing srg-11 to detect changes in neuronal activity in response to stimuli

    • Comparison between wild-type and mutant animals to identify defects in signal transduction

  • Genetic interaction studies:

    • Creating double mutants with other chemosensory genes to identify genetic pathways

    • Rescue experiments with wild-type srg-11 to confirm phenotype specificity

  • Developmental analysis:

    • Assessment of sensory neuron morphology and connectivity in srg-11 mutants

    • Temporal expression studies to determine when srg-11 function is required

Researchers should be aware that laboratory adaptation can affect chemosensory behaviors, as seen in the N2 strain of C. elegans which "is quite distinct from natural isolates of C. elegans for a variety of developmental, physiological, and behavioral traits" . Therefore, testing in multiple genetic backgrounds, including wild isolates, is recommended for comprehensive analysis.

What are the best practices for generating and characterizing srg-11 knockout models?

For generating and characterizing srg-11 knockout models in C. elegans or other model organisms, researchers should follow these methodological approaches:

  • Knockout generation strategies:

    • CRISPR/Cas9 genome editing for precise gene deletion or modification

    • Traditional homologous recombination for targeted mutations

    • Transposon-based mutagenesis for random insertions

    • RNAi for transient knockdown to assess potential phenotypes before creating stable lines

  • Validation of knockout models:

    • Molecular verification using PCR and sequencing to confirm the intended genetic modification

    • Expression analysis (RT-PCR, RNA-seq) to verify absence of transcript

    • Western blotting or immunostaining (if antibodies are available) to confirm protein absence

  • Phenotypic characterization:

    • Comprehensive behavioral assays focusing on chemosensation

    • Life history trait analysis (development, reproduction, lifespan)

    • Stress response and environmental adaptation tests

    • Cell-specific rescue experiments to determine the anatomical focus of gene function

  • Controls and considerations:

    • Include multiple independent knockout lines to control for off-target effects

    • Use appropriate wild-type controls from the same genetic background

    • Be aware of potential laboratory adaptation effects as documented for other strains

    • Consider testing phenotypes under various environmental conditions, as receptor function may be condition-dependent

When interpreting results, researchers should consider potential compensatory mechanisms by other serpentine receptors, as the genome of C. elegans contains numerous related genes that may have overlapping functions.

How can srg-11 be used to study evolution of chemosensory systems across nematode species?

Serpentine receptors represent excellent models for studying evolutionary processes due to their rapid diversification and adaptation to different ecological niches. For studying the evolution of chemosensory systems using srg-11 as a model:

  • Comparative genomic approaches:

    • Sequence srg-11 orthologs from multiple nematode species with different ecological niches

    • Calculate selection pressures (dN/dS ratios) to identify regions under positive or purifying selection

    • Analyze gene duplication events and subsequent diversification within the srg family

  • Experimental evolution studies:

    • Use approaches similar to those outlined for Caenorhabditis experimental evolution

    • Design selection experiments that target chemosensory adaptation

    • Compare responses across species with different mating systems (selfing vs. outcrossing)

  • Functional comparative analysis:

    • Express srg-11 from different species in a common genetic background to test for functional differences

    • Use chimeric receptors to identify domains responsible for ligand specificity

    • Test responses to ecologically relevant chemicals for each species

  • Ecological correlations:

    • Correlate sequence variation with habitat preferences and host associations

    • Test for convergent evolution in receptors from distantly related species occupying similar niches

This research approach would build on observations from laboratory domestication studies, which have shown that "adaptation to laboratory conditions rendered individuals resistant to the pheromone-induced dauer larval formation" through deletions in pheromone receptor genes like srg-36 and srg-37 . Similar selective pressures may act on srg-11 in different ecological contexts.

What are the current challenges in determining the three-dimensional structure of srg-11 and other serpentine receptors?

Determining the three-dimensional structure of serpentine receptors like srg-11 presents several challenges that researchers should be aware of:

  • Expression and purification challenges:

    • As transmembrane proteins, serpentine receptors are difficult to express in functional form

    • Cell-free expression systems may offer advantages for maintaining proper protein folding

    • Detergent selection is critical for maintaining protein stability during purification

    • Low natural abundance requires recombinant expression strategies

  • Crystallization difficulties:

    • High flexibility of loop regions complicates crystal formation

    • Lipid environment significantly affects protein conformation

    • Receptor stability often depends on ligand binding

    • Heterogeneity in post-translational modifications

  • Alternative structural determination approaches:

    • Cryo-electron microscopy (cryo-EM) for structure determination without crystallization

    • Nuclear magnetic resonance (NMR) for studying dynamic regions

    • Molecular dynamics simulations to predict conformational changes

    • Comparative modeling based on related GPCRs with known structures

  • Current methodological advances:

    • Nanobody or antibody fragment co-crystallization to stabilize specific conformations

    • Lipid cubic phase crystallization methods for membrane proteins

    • Thermostabilizing mutations to improve protein stability

    • GPCR fusion proteins to facilitate crystallization

A comprehensive approach would combine multiple methods, starting with homology modeling based on related receptors with known structures, followed by experimental validation using techniques like site-directed mutagenesis and ligand binding assays to refine structural predictions.

How does srg-11 function compare with other serpentine receptor classes in C. elegans?

Understanding the functional relationships between srg-11 and other serpentine receptor classes requires comparative analysis:

  • Functional comparison with sra-11:
    Serpentine receptor class alpha-11 (sra-11) is "specifically required for olfactory imprinting" and "functions in interneurons downstream of the sensory neuron class to control olfactory imprinting" . It is involved in odorant response to compounds such as benzaldehyde and isoamylalcohol. Comparing srg-11 with sra-11 would involve:

    • Expression pattern analysis using reporter genes

    • Testing responses to the same odorants

    • Determining if srg-11 functions in sensory neurons or interneurons

    • Investigating potential interactions or redundancies between receptor classes

  • Comparison with pheromone receptors srg-36 and srg-37:
    These receptors are involved in pheromone-induced dauer formation, and their deletion confers resistance to this process . Comparative studies should:

    • Test if srg-11 also responds to dauer pheromones

    • Examine expression patterns in amphid neurons

    • Investigate potential developmental roles

    • Analyze differences in adaptation to laboratory conditions

  • Functional analysis across receptor classes:
    A comprehensive comparison would involve creating a functional map of:

    • Ligand specificity profiles

    • Downstream signaling pathways

    • Neuronal expression patterns

    • Behavioral outputs controlled by each receptor

  • Evolutionary comparison:

    • Analysis of gene duplication patterns across receptor families

    • Identification of conserved vs. divergent functional domains

    • Examination of species-specific expansions of particular receptor classes

This comparative approach would help position srg-11 within the broader context of chemosensory processing in nematodes and identify unique functional aspects of this receptor class.

What methodologies are most effective for studying ligand-receptor interactions for srg-11?

For investigating ligand-receptor interactions of srg-11, researchers can employ several complementary approaches:

  • In vitro binding assays:

    • Surface plasmon resonance (SPR) to measure binding kinetics

    • Fluorescence-based ligand binding assays

    • Radiolabeled ligand competition assays

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Functional assays in heterologous expression systems:

    • Calcium mobilization assays using calcium-sensitive fluorescent dyes

    • BRET/FRET-based conformational change assays

    • GTPγS binding assays to measure G-protein activation

    • β-arrestin recruitment assays for receptor internalization

  • Computational approaches:

    • Molecular docking to predict binding sites

    • Molecular dynamics simulations to study conformational changes

    • Virtual screening to identify potential ligands

    • Pharmacophore modeling based on known ligands

  • Structure-function analysis:

    • Alanine scanning mutagenesis of predicted binding pocket residues

    • Chimeric receptors combining domains from different receptor classes

    • Reporter gene assays to quantify receptor activation

    • Site-directed mutagenesis guided by computational predictions

A systematic approach would first identify candidate ligands based on behavioral responses in C. elegans, followed by in vitro validation using heterologous expression systems, and finally detailed mechanistic studies using the methods outlined above. This approach has been effective for characterizing other serpentine receptors and could be applied to srg-11 research.

How can understanding srg-11 function contribute to controlling parasitic nematodes?

Research on serpentine receptors like srg-11 has potential applications for controlling parasitic nematodes that affect agriculture and human health:

  • Targetable differences between host and parasite:

    • Serpentine receptors are highly divergent between nematodes and mammals

    • Species-specific receptors may allow for selective targeting

    • Understanding ligand specificity can guide development of specific attractants or repellents

  • Potential intervention strategies:

    • Development of receptor antagonists to disrupt host-finding or mating behaviors

    • Design of synthetic agonists to interfere with normal development

    • Creation of traps using receptor ligands as attractants

    • RNAi approaches targeting receptor expression in field applications

  • Research approach for parasitic applications:

    • Identify and characterize srg-11 orthologs in parasitic nematode species

    • Compare ligand specificities between free-living and parasitic species

    • Test candidate compounds for effects on parasite behavior and development

    • Develop high-throughput screening systems for compound libraries

  • Resistance management considerations:

    • Study potential for resistance development through receptor mutations

    • Design multi-target approaches to reduce resistance risk

    • Investigate receptor family redundancy that might compensate for single receptor targeting

Drawing parallels from research on laboratory adaptation, where deletions in srg-36 and srg-37 conferred resistance to pheromone-induced dauer formation , similar mechanisms might be exploited to disrupt critical developmental transitions in parasitic nematodes.

What are the emerging technologies that could advance srg-11 research in the next decade?

Several emerging technologies hold promise for advancing srg-11 research:

  • Single-cell transcriptomics and proteomics:

    • Characterization of cell-specific expression patterns

    • Identification of co-expressed genes suggesting functional pathways

    • Temporal analysis of expression during development and in response to stimuli

    • Discovery of rare cell populations expressing srg-11

  • Advanced genome editing techniques:

    • Prime editing for precise sequence modifications without double-strand breaks

    • Base editing for targeted nucleotide substitutions

    • Conditional knockout systems for temporal and spatial control

    • High-throughput CRISPR screening for functional genomics

  • Structural biology advances:

    • Cryo-EM improvements for membrane protein structures

    • Integrative structural biology combining multiple data sources

    • In-cell structural studies under native conditions

    • Computational approaches for predicting dynamic structural changes

  • Functional imaging technologies:

    • Genetically encoded sensors for G-protein signaling

    • Optogenetic tools for controlling receptor activity

    • Super-resolution microscopy for tracking receptor localization

    • In vivo calcium imaging with cellular resolution

  • Synthetic biology approaches:

    • Designer receptors exclusively activated by designer drugs (DREADDs)

    • Synthetic circuits for testing receptor function

    • Cell-free expression systems for high-throughput functional testing

    • Reconstituted biological systems to study receptor function in controlled environments

The integration of these technologies would enable comprehensive characterization of srg-11 from molecular interactions to whole-organism phenotypes, significantly advancing our understanding of this receptor class.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.