Recombinant Serpentine receptor class gamma-15 (srg-15)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific format requirements, please indicate them during order placement. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. This can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its inclusion if feasible.
Synonyms
srg-15; C34C6.1; Serpentine receptor class gamma-15; Protein srg-15
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-320
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
srg-15
Target Protein Sequence
MTTNYSEPDPLVCDETYSSSIEILKYLLTISYLIPGGILHLFILHTILVTRRGYFKGSSF FAIFALDSVSSIIIVFIDSFYGRLFLYVPPLCPIVGPFFWASSLIPKIYFYLSVHTRLSK CVAHICMVLNRMTCVLMPTYYGQIWRKLTKVSLVIICILPLGGTWNIIISPRFYVLPSYG GFAISYVRAIPWASSSLFQSIYILTALVFTFICTSVTLYKLISLSDRIKSAEKSLCFSNI YISLTFLAAAASQALYAFCTSCMSSDLLFTAQFLAFDMFTVGSAVILFWSNSQIRGLILP SKAEDDRIFRVQTINNSFTH
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_C34C6.1

UniGene: Cel.25996

Protein Families
Nematode receptor-like protein srg family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Serpentine receptor class gamma-15 (srg-15) and what is its significance in research?

Serpentine receptor class gamma-15 (srg-15) is a G-protein-coupled receptor (GPCR) found in the nematode Caenorhabditis elegans. This 320-amino acid transmembrane protein belongs to the Rhodopsin-like Class A family of GPCRs, which are characterized by their seven-transmembrane domain structure. The srg-15 protein (UniProt ID: Q18428) is also known as C34C6.1 .

GPCRs represent the largest group of membrane receptors responsible for transducing extracellular signals to various downstream effectors, controlling major biological and pathological processes . Studying srg-15 provides insights into chemosensation and signal transduction in C. elegans, which serves as an important model organism for investigating conserved biological processes.

  • What are the key structural characteristics of the srg-15 protein?

Recombinant srg-15 has the following structural characteristics:

Structural FeatureDescription
Protein LengthFull Length (1-320 amino acids)
Transmembrane DomainsSeven transmembrane domains typical of Class A GPCRs
N-terminal DomainShort extracellular region
C-terminal DomainIntracellular region involved in G-protein coupling
Amino Acid SequenceMTTNYSEPDPLVCDETYSSSIEILKYLLTISYLIPGGILHLFILHTILVTRRGYFKGSSFFAIFALDSVSSIIIVFIDSFYGRLFLYVPPLCPIVGPFFWASSLIPKIYFYLSVHTRLSKCVAHICMVLNRMTCVLMPTYYGQIWRKLTKVSLVIICILPLGGTWNIIISPRFYVLPSYGGFAISYVRAIPWASSSLFQSIYILTALVFTFICTSVTLYKLISLSDRIKSAEKSLCFSNIYISLTFLAAAASQALYAFCTSCMSSDLLFTAQFLAFDMFTVGSAVILFWSNSQIRGLILPSKAEDDRIFRVQTINNSFTH

Like other Class A GPCRs, srg-15 likely contains a GpcrRhopsn4 domain and uses conformational changes to transduce signals from extracellular stimuli to intracellular signaling pathways .

  • What expression systems are optimal for producing recombinant srg-15?

E. coli is the most documented expression system for recombinant srg-15 production. The protocol typically involves:

  • Cloning the full-length srg-15 gene (1-320aa) into an appropriate expression vector

  • Adding an N-terminal His tag for purification purposes

  • Transforming the construct into E. coli cells

  • Inducing protein expression under optimized conditions

  • Lysing cells and purifying the protein using affinity chromatography

Alternative expression systems may include:

  • Cell-free protein synthesis (CFPS) systems, which have been used for other GPCRs but may require optimization for maintaining proper tertiary structure

  • Yeast, baculovirus, or mammalian cell expression systems, which might provide better post-translational modifications for functional studies

The choice of expression system should be guided by the intended downstream applications and whether native folding and post-translational modifications are required.

  • What are the recommended storage conditions for recombinant srg-15 protein?

Optimal storage conditions for recombinant srg-15 protein are:

  • Store at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • For long-term storage, reconstituted protein should be supplemented with 5-50% glycerol (final concentration) and stored at -20°C/-80°C

  • The recommended storage buffer is Tris/PBS-based buffer containing 6% Trehalose, pH 8.0

Important note: Repeated freezing and thawing is not recommended as it can lead to protein denaturation and loss of activity .

  • How should lyophilized srg-15 protein be reconstituted for experimental use?

The recommended reconstitution protocol for lyophilized srg-15 protein is:

  • Briefly centrifuge the vial prior to opening to bring the contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is the default recommendation)

  • Aliquot for long-term storage at -20°C/-80°C

  • Allow the protein to fully dissolve before using in experiments

This protocol helps maintain protein stability and prevents activity loss during storage and subsequent experimental use.

Advanced Research Questions

  • What techniques are most effective for studying srg-15 function in C. elegans?

Multiple complementary approaches can be employed to study srg-15 function in C. elegans:

  • Genetic manipulation:

    • CRISPR/Cas9 gene editing to create knockout, knockin, or point mutations

    • RNAi-mediated knockdown using feeding, injection, or soaking methods

    • Transgenic rescue experiments with wild-type or mutated srg-15 constructs

  • Expression analysis:

    • Transcriptional GFP reporters to identify spatial and temporal expression patterns

    • Single-molecule FISH to quantify transcript levels in specific cells

    • Immunohistochemistry with anti-srg-15 antibodies to localize protein expression

  • Functional assays:

    • Chemotaxis assays to assess sensory functions

    • Calcium imaging to monitor neuronal activation in response to stimuli

    • Electrophysiological recordings to measure cellular responses

  • Behavioral studies:

    • Tracking assays to monitor movement patterns

    • Food preference assays to evaluate chemosensory functions

    • Mating behavior analysis to assess potential roles in reproduction

Integrating multiple approaches allows for a comprehensive understanding of srg-15's biological roles and signaling mechanisms.

  • How can researchers design experiments to elucidate srg-15 signaling pathways?

To investigate srg-15 signaling pathways, researchers should implement a systematic approach:

  • Identify G-protein coupling specificity:

    • Use co-immunoprecipitation to identify G-proteins that interact with srg-15

    • Perform BRET (Bioluminescence Resonance Energy Transfer) assays to monitor G-protein activation

    • Use G-protein subunit-specific inhibitors to determine coupling preferences

  • Map downstream effectors:

    • Monitor second messenger production (cAMP, cGMP, Ca²⁺, IP₃) after srg-15 activation

    • Use phosphorylation-specific antibodies to identify activated kinases

    • Perform RNA-seq after srg-15 activation to identify transcriptional responses

  • Validate findings with genetic approaches:

    • Create mutations in suspected pathway components

    • Perform epistasis analysis using double mutants

    • Use RNAi to knock down pathway components and assess effects on srg-15-mediated responses

For example, epistasis analysis has been successfully used to delineate signaling pathways in C. elegans, such as the EGL-15 signaling pathway, which involves let-60 ras and components of a mitogen-activated protein kinase cascade .

  • What are the challenges in studying membrane proteins like srg-15 and how can they be overcome?

Studying membrane proteins like srg-15 presents several challenges:

ChallengeSolution Approaches
Low expression levelsOptimize codon usage, use stronger promoters, or specialized expression hosts
Protein misfoldingExpress in eukaryotic systems, use solubilizing tags, or optimize buffer conditions
Detergent compatibilityScreen multiple detergents for extraction efficiency and protein stability
Functional reconstitutionUse liposomes or nanodiscs to mimic native membrane environment
Structural analysis difficultiesApply specialized techniques like cryo-EM or NMR for membrane proteins
Ligand identificationEmploy high-throughput screening approaches or computational docking studies

Recent advances with cell-free protein synthesis (CFPS) systems provide an alternative approach, although challenges remain with ensuring proper folding and tertiary structure of GPCRs . When using CFPS systems, researchers should validate the functionality of the expressed protein through ligand binding assays or structural analyses to ensure native conformation has been achieved.

  • How can evolutionary analysis of srg-15 inform functional studies?

Evolutionary analysis of srg-15 can provide valuable insights:

  • Sequence conservation analysis:

    • Compare srg-15 sequences across nematode species to identify conserved regions

    • Use conservation patterns to predict functionally important domains

    • Identify species-specific variations that might relate to ecological adaptations

  • Phylogenetic approaches:

    • Construct phylogenetic trees of serpentine receptor genes to understand evolutionary relationships

    • Compare with other GPCR families to identify unique features of srg family

    • Analyze selection pressures on different domains of the protein

  • Comparative genomics:

    • Examine syntenic regions around srg-15 in different species

    • Identify co-evolved genes that might function in the same pathway

    • Compare regulatory regions to understand expression pattern evolution

Such analyses can identify functionally critical residues that have been conserved through evolution and guide site-directed mutagenesis experiments to test their roles in receptor function.

  • What methodologies are recommended for investigating srg-15's role in C. elegans sensory biology?

To investigate srg-15's role in sensory biology, researchers should consider:

  • Neuronal mapping:

    • Use cell-specific promoters to express fluorescent proteins in srg-15-expressing neurons

    • Perform laser ablation of identified neurons to assess behavioral consequences

    • Apply connectomics data to place srg-15-expressing neurons in the sensory network

  • Stimulus identification:

    • Screen chemical libraries to identify potential ligands

    • Test environmental conditions (temperature, oxygen levels) that might activate srg-15

    • Examine natural compounds present in the worm's habitat

  • Functional imaging:

    • Express calcium indicators (GCaMP) in srg-15-positive neurons

    • Monitor neural activity in response to potential stimuli

    • Compare responses in wild-type and srg-15 mutant animals

  • Behavioral assays:

    • Design chemotaxis assays specific to hypothesized srg-15 ligands

    • Analyze behaviors under controlled oxygen environments

    • Study responses to environmental stressors

For example, researchers have found that certain serpentine receptors in C. elegans are involved in sensing environmental cues that affect sperm navigation, suggesting complex roles for these receptors in reproductive biology .

  • How can researchers validate antibodies or other tools for studying srg-15?

Rigorous validation of research tools for srg-15 studies should include:

  • Antibody validation:

    • Test specificity using wild-type vs. srg-15 knockout samples

    • Perform peptide competition assays to confirm epitope specificity

    • Validate across multiple applications (Western blot, immunohistochemistry, immunoprecipitation)

    • Confirm localization patterns match transcriptional reporter results

  • Expression construct validation:

    • Sequence verify all constructs

    • Confirm protein expression via Western blot

    • Verify subcellular localization using confocal microscopy

    • Test functionality through rescue experiments in srg-15 mutants

  • RNAi construct validation:

    • Confirm target specificity using bioinformatics

    • Measure knockdown efficiency via qPCR or Western blot

    • Test for off-target effects using control RNAi constructs

    • Validate phenotypes by comparison with genetic mutants

These validation steps ensure experimental reliability and reproducibility, which is particularly important for membrane proteins like srg-15 where tools may have limitations due to protein hydrophobicity and complex tertiary structure.

  • What approaches can be used to study potential roles of srg-15 in C. elegans development or physiology?

To investigate developmental or physiological roles of srg-15, researchers should consider:

  • Temporal expression analysis:

    • Monitor srg-15 expression throughout development using transcriptional reporters

    • Perform stage-specific RNAi to identify critical periods for srg-15 function

    • Use temperature-sensitive mutations for temporal control of gene function

  • Phenotypic analysis:

    • Examine growth rates, body size, and developmental timing in srg-15 mutants

    • Assess reproductive parameters including brood size and embryonic development

    • Analyze metabolic profiles using techniques like mass spectrometry

    • Measure lifespan and stress resistance under various conditions

  • Tissue-specific studies:

    • Use tissue-specific promoters to rescue srg-15 function in mutant backgrounds

    • Perform tissue-specific knockdown to identify sites of action

    • Analyze cell autonomy and non-autonomy of srg-15 functions

  • Environmental interaction studies:

    • Examine srg-15 functions under different oxygen levels, temperature, or food conditions

    • Test for environmental effects on gene expression and receptor localization

    • Investigate potential epigenetic effects across generations

Such comprehensive approaches can reveal unexpected roles for srg-15 beyond traditional chemosensory functions, as seen with other serpentine receptors in C. elegans that influence reproductive biology and development .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.