Recombinant Serpentine receptor class gamma-17 (srg-17)

Shipped with Ice Packs
In Stock

Description

Production and Purification

srg-17 is synthesized using diverse expression systems, with varying yields and purification methods:

SystemHostPurification MethodPurityTagSource
BaculovirusInsect cellsAntigen-affinity chromatography>85% (SDS-PAGE)N-terminal/C-terminal
E. coliBacterial cellsNi-NTA affinity chromatography>90%His-tag
Mammalian CellsHEK293 or CHO cellsSize-exclusion chromatography>95%Fc-tag

Purification methods include antigen-affinity chromatography for insect-cell systems and Ni-NTA for bacterial systems . Lyophilized forms are stable at -20°C/-80°C, while liquid forms have a 6-month shelf life .

Applications in Research

srg-17 is utilized in several experimental contexts:

Research Findings and Limitations

Current studies highlight srg-17’s utility as a research tool but reveal gaps in functional characterization:

  • Expression Patterns: Upregulated in C. elegans developmental stages, though specific triggers remain unclear .

  • Functional Inference: Homology to GPCRs suggests roles in ligand binding and downstream signaling, but experimental validation is lacking .

  • Therapeutic Potential: While explored in vaccine contexts, no clinical applications have been reported .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipment is required, please notify us in advance. Additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize the development of your specified tag.
Synonyms
srg-17; F15A4.7; Serpentine receptor class gamma-17; Protein srg-17
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-320
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
srg-17
Target Protein Sequence
MGTTNLTLDSESICDPNYDILFENAIYFVTACYLSVGLFCHISLLKIILISDRKYFKDNS FFVLFRADLFASTTLLLYDIFFGRIFMYIPQLCPFVSTFFSTPTIFLKVLYVAQNHARFV KSLSQIFMVLNRMSCVLMPATYNQFWNKITPIASFIMLILPFAGLWNIMISQVIASSVRG GFGVDYIKAVKWASLSLFQSICILTALGFTIVCTSVTFYKLACLSDRVRSIERSLCFTSI SISCTFLLVAGTQLTFATCASCKTDAMYILQFLAFDTFNVGSAIIMFLTNRHLRSSMFSS QKKRAVTVVTVGQISTNTYN
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_F15A4.7

UniGene: Cel.26425

Protein Families
Nematode receptor-like protein srg family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Serpentine receptor class gamma-17 (srg-17)?

Serpentine receptor class gamma-17 (srg-17) is a multi-pass membrane protein that belongs to the nematode receptor-like protein srg family. The protein has a molecular weight of approximately 36,089 Da and consists of 320 amino acid positions. It contains an N-terminal tag and may also contain a C-terminal tag depending on the recombinant preparation method. The protein is primarily expressed in membrane structures with multiple transmembrane domains characteristic of serpentine receptors .

How does srg-17 compare structurally to other receptors in its class?

Srg-17 shares structural homology with other serpentine receptors, particularly in its transmembrane domains. Like other members of the serpentine receptor family, it contains multiple membrane-spanning regions creating a characteristic folding pattern. While not explicitly documented in the available data for srg-17, related receptor proteins such as SIRP gamma show homology in their extracellular domains but significant variability in their C-terminus and signaling functions . The nematode receptor-like protein srg family, to which srg-17 belongs, typically features conserved regions that maintain structural integrity while allowing functional specialization .

What expression systems are most effective for producing recombinant srg-17?

Based on successful recombinant protein production methods for similar membrane proteins, the optimal expression systems for srg-17 include:

Expression SystemAdvantagesLimitationsTypical Yield
E. coliCost-effective, rapid growthMay form inclusion bodies5-20 mg/L
Baculovirus/insect cellsBetter folding for membrane proteinsHigher cost, longer production time10-50 mg/L
Mammalian cellsNative-like post-translational modificationsHighest cost, complex media requirements1-10 mg/L

The selection depends on research requirements for protein folding, post-translational modifications, and downstream applications. When expressing recombinant srg-17, consideration should be given to the tag systems used, as these can affect both purification efficiency and protein functionality .

What are the critical factors to consider when designing experiments with recombinant srg-17?

When designing experiments with recombinant srg-17, researchers should establish a framework of protocols using two sets of variables, where one set acts as a constant to measure differences in the second set. This approach is fundamental to quantitative research methodologies . Critical considerations include:

  • Protein stability and storage conditions to maintain functional integrity

  • Selection of appropriate buffer systems compatible with membrane proteins

  • Consideration of detergent types for solubilization while maintaining native structure

  • Incorporation of controls to account for the influence of tags on protein behavior

  • Validation of protein activity through appropriate binding or functional assays

Each experimental variable should be carefully controlled to ensure reproducibility and valid interpretation of results. Time-dependent relationships between cause and effect should be considered, especially when evaluating the invariable behaviors between these factors .

How should researchers approach optimization of srg-17 expression and purification?

Optimization of srg-17 expression and purification requires a systematic approach:

  • Expression optimization:

    • Test multiple expression vectors with different promoter strengths

    • Evaluate various induction conditions (temperature, inducer concentration, time)

    • Compare codon-optimized versus native gene sequences

    • Screen multiple host strains for compatibility with membrane protein expression

  • Purification strategy:

    • Begin with affinity chromatography leveraging the protein's N-terminal or C-terminal tags

    • Implement size exclusion chromatography to separate monomeric from aggregated protein

    • Consider ion exchange chromatography as a polishing step

    • Validate protein purity through SDS-PAGE under both reducing and non-reducing conditions, similar to the methodology used for SIRP gamma/CD172g protein analysis

Tracking purification efficiency at each step through activity assays provides critical feedback for protocol refinement.

How can researchers effectively investigate srg-17 interaction with potential binding partners?

Investigating srg-17 interactions requires a multi-faceted approach:

  • Binding assays: Surface Plasmon Resonance (SPR) or Bio-Layer Interferometry (BLI) can quantify binding kinetics. Similar to the approach used with SIRP gamma and CD47, researchers should immobilize potential binding partners at controlled concentrations (e.g., 0.5 μg/mL) and determine the ED50 of srg-17 binding .

  • Co-immunoprecipitation: For identifying novel interaction partners in complex biological samples.

  • Proximity labeling: BioID or APEX2 fusion proteins can identify proteins in close proximity to srg-17 in living cells.

  • Functional validation: Following identification of binding partners, functional relevance should be confirmed through knockdown/knockout studies or competitive inhibition assays.

When designing these experiments, researchers should consider that, like SIRP gamma which lacks obvious signaling mechanisms despite its role in cellular adhesion, srg-17 may participate in protein complexes that collectively mediate signaling pathways .

What methodologies are most effective for investigating the membrane topology of srg-17?

To determine the membrane topology of srg-17 accurately, researchers should employ complementary approaches:

MethodApplicationAdvantagesLimitations
Protease protection assaysIdentification of exposed domainsSimple setup, minimal equipmentLow resolution
Cysteine scanning mutagenesisMapping accessible residuesHigh resolution, functional contextLabor-intensive
Fluorescence resonance energy transfer (FRET)Dynamic protein interactionsIn vivo applicabilityComplex data interpretation
Cryo-electron microscopyFull structural determinationHighest resolutionResource-intensive, challenging for membrane proteins

How should researchers approach contradictory results in srg-17 functional studies?

When confronted with contradictory results in srg-17 functional studies, implement a systematic troubleshooting approach:

  • Verify protein integrity: Confirm that the recombinant protein maintains its native structure through circular dichroism or limited proteolysis.

  • Check experimental conditions: Evaluate buffer components, pH, temperature, and ionic strength for compatibility with membrane protein function.

  • Assess potential tag interference: Compare results using constructs with different tag positions or cleavable tags.

  • Cross-validate with orthogonal methods: If one assay type gives contradictory results, implement alternative assay formats that measure the same parameter.

  • Examine cellular context: Results from cell-free systems may differ from cellular environments due to missing cofactors or interacting proteins.

Researchers should document all variables meticulously when publishing results to facilitate reproduction and comparison across studies .

What statistical approaches are most appropriate for analyzing srg-17 binding and functional data?

The appropriate statistical approaches for srg-17 data analysis depend on the experimental design and data characteristics:

  • For binding kinetics:

    • Non-linear regression for determining KD, kon, and koff values

    • Scatchard or Hill plots for assessing binding cooperativity

    • ANOVA for comparing binding across multiple experimental conditions

  • For functional assays:

    • Dose-response curves with EC50/IC50 determination

    • Two-way ANOVA for experiments with multiple variables

    • Time-series analysis for temporal response patterns

  • For structural studies:

    • Cluster analysis for conformational states

    • Principal component analysis for identifying major structural variations

Statistical power calculations should be performed prior to experiments to ensure adequate sample sizes. When reporting results, provide both the effect size and p-values to allow complete interpretation of the data's biological significance .

What are the most common challenges in working with recombinant srg-17 and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant srg-17:

  • Low expression yields:

    • Solution: Optimize codon usage for the expression host

    • Test fusion partners known to enhance membrane protein expression

    • Consider specialized expression strains designed for toxic or membrane proteins

  • Protein aggregation:

    • Solution: Screen multiple detergents at various concentrations

    • Include stabilizing agents like glycerol or specific lipids

    • Reduce expression temperature to slow folding and reduce inclusion body formation

  • Loss of function during purification:

    • Solution: Minimize exposure to harsh conditions

    • Include ligands or stabilizing molecules during purification

    • Consider native purification approaches that maintain the lipid environment

  • Variable reproducibility between batches:

    • Solution: Implement rigorous quality control checks

    • Standardize expression and purification protocols with precise timing

    • Develop functional assays to verify each batch meets activity specifications

These challenges align with those observed for other membrane proteins like SIRP gamma, where maintaining native conformation is critical for functional studies .

How can researchers overcome difficulties in structural characterization of srg-17?

Structural characterization of membrane proteins like srg-17 presents unique challenges that can be addressed through several strategies:

  • For crystallography challenges:

    • Implement protein engineering to remove flexible regions while maintaining function

    • Screen stabilizing mutations that enhance thermostability

    • Use antibody fragments or nanobodies to stabilize specific conformations

    • Explore lipidic cubic phase crystallization specifically designed for membrane proteins

  • For NMR studies:

    • Consider selective isotopic labeling to focus on specific domains

    • Use detergent screening to identify conditions with minimal signal broadening

    • Implement TROSY-based methods optimized for large membrane proteins

  • For cryo-EM approaches:

    • Optimize grid preparation to prevent preferential orientation

    • Consider using Saposin-based nanoparticles or nanodiscs to present the protein in a lipid environment

    • Implement computational approaches for dealing with flexibility

These methodological adaptations have proven successful with other serpentine receptors and membrane proteins with similar structural complexities .

What are the most promising approaches for studying srg-17 in its native cellular context?

Studying srg-17 in its native cellular context requires techniques that preserve physiological relevance while enabling detailed molecular analysis:

  • CRISPR gene editing:

    • Endogenous tagging of srg-17 for live-cell imaging

    • Creation of conditional knockouts to study temporal requirements

    • Domain-specific mutations to map functional regions

  • Advanced microscopy approaches:

    • Super-resolution imaging to visualize membrane distribution and dynamics

    • Single-molecule tracking to observe diffusion and complex formation

    • FRET-based sensors to detect conformational changes upon ligand binding

  • Organoid and tissue-specific models:

    • Development of organoid cultures that recapitulate native expression patterns

    • Tissue-specific expression systems to study context-dependent functions

    • In vivo models with tissue-specific or inducible expression

These approaches allow researchers to bridge the gap between reductionist in vitro studies and physiologically relevant cellular contexts, providing insights into how srg-17 functions within its native membrane environment and cellular signaling networks .

How might computational approaches enhance srg-17 research?

Computational approaches offer powerful complements to experimental studies of srg-17:

Computational MethodApplication to srg-17 ResearchExpected Insights
Homology modelingPrediction of 3D structureIdentification of potential binding pockets and functional domains
Molecular dynamics simulationsAnalysis of protein dynamicsUnderstanding of conformational changes and membrane interactions
Machine learning algorithmsMining of literature and databasesDiscovery of patterns across related proteins and potential functions
Systems biology approachesIntegration with pathway dataContextualizing srg-17 function within broader cellular networks
Virtual screeningIdentification of potential ligandsDiscovery of tool compounds for functional studies

These computational approaches can guide experimental design by generating testable hypotheses about srg-17 structure, function, and interaction partners. The integration of computational and experimental strategies creates a powerful iterative research cycle that accelerates discovery while minimizing resource expenditure .

What are the current consensus views and knowledge gaps regarding srg-17 function?

  • The natural ligands or binding partners of srg-17

  • Its precise signaling mechanisms and downstream pathways

  • Tissue-specific expression patterns and their functional significance

  • Evolutionary conservation and divergence of function across species

  • Potential roles in development, physiology, or disease states

These knowledge gaps represent promising areas for further investigation, particularly through comparative studies with better-characterized serpentine receptors like SIRP gamma that have established roles in cellular adhesion and immune cell function .

What best practices should researchers follow when publishing srg-17 research findings?

Researchers publishing srg-17 findings should adhere to these best practices:

  • Detailed methodology reporting:

    • Provide complete recombinant protein sequences including all tags

    • Specify expression systems, purification methods, and buffer compositions

    • Document quality control measures (e.g., purity assessments, activity verification)

  • Comprehensive data presentation:

    • Include representative images of key experiments

    • Present both raw data and processed results where appropriate

    • Use standardized formats for binding data (e.g., Scatchard plots, sensorgrams)

  • Contextual interpretation:

    • Discuss findings in relation to other serpentine receptors

    • Acknowledge limitations of experimental approaches

    • Suggest specific follow-up studies to address remaining questions

  • Data and resource sharing:

    • Deposit sequences in public databases

    • Share plasmids through repositories

    • Provide detailed protocols as supplementary materials

Following these practices ensures that published research makes maximal contribution to the field while enabling reproduction and extension by other researchers .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.