Recombinant Serpentine receptor class gamma-1 (srg-1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference when placing the order. We will prepare the product according to your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
srg-1; C18F10.4; Serpentine receptor class gamma-1; Protein srg-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-288
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
srg-1
Target Protein Sequence
MPINETASVTNCDTNFEPLIENLKLFLQLCYLTPSALFLSRVIYITAWKYRKKFRKQRFY TIFLADCVTGFILVNFSIFFTRPLIYVPQACEFVLEHIKKLALFLDIYYPCFRYLQAFQI LVQILFVANRASCVLWPLSYSLFWKKWLKSILTTMAISPCLWIWTIAISDKMIVHGYGGL VVLYYRYVSWARSTLFFSILRLTSVITIVVATTTMLIKMSRMKKRIRESERRLCWASVYL SVCYLLPAIAEFEYFLVLKAKLFENSGILHGLVVICWDIQNICSTYVM
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_C18F10.4

STRING: 6239.C18F10.4

UniGene: Cel.29189

Protein Families
Nematode receptor-like protein srg family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Serpentine receptor class gamma-1 (srg-1) and what organism is it found in?

Serpentine receptor class gamma-1 (srg-1) is a G-protein coupled receptor (GPCR) found in Caenorhabditis elegans. It is a full-length protein consisting of 288 amino acids that functions as a transmembrane receptor involved in signal transduction pathways . Unlike other serpentine receptors that may be found across multiple species, srg-1 appears to be specific to C. elegans, making it a valuable model for studying nematode-specific signaling mechanisms and potential targets for anthelmintic development.

How does srg-1 compare structurally and functionally to other serpentine receptors in C. elegans?

Structurally, srg-1 belongs to the larger family of serpentine receptors in C. elegans, sharing the characteristic seven-transmembrane domain architecture common to GPCRs. When compared to other members of the srg family like srg-5 and srg-9, there are notable differences in protein length (srg-1 is 288 amino acids while srg-9 is 336 amino acids) . Functionally, these receptors likely interact with specific ligands and downstream signaling partners, though the precise ligand for srg-1 remains to be fully characterized. The serpentine receptor class gamma proteins appear to have diverged to serve specialized functions within C. elegans, potentially responding to different environmental or internal cues.

What expression systems are commonly used for producing recombinant srg-1 protein?

The primary expression system used for recombinant srg-1 production is Escherichia coli, which allows for cost-effective protein expression with reasonable yields . The recombinant protein is typically produced with a histidine tag to facilitate purification through affinity chromatography methods. Alternative expression systems such as yeast, baculovirus, or mammalian cell lines (as seen with related proteins like srg-5) might offer advantages for specific research applications, particularly when post-translational modifications or proper protein folding are critical . Each system presents different advantages regarding yield, cost, post-translational modifications, and functional integrity of the expressed protein.

What are the key considerations when designing experiments to study srg-1 function in C. elegans?

When designing experiments to study srg-1 function, researchers must carefully define their variables and develop a testable hypothesis about srg-1 role . Independent variables might include genetic manipulations of srg-1 (knockdown, knockout, overexpression), while dependent variables could include phenotypic changes, downstream signaling responses, or interaction with other proteins. Researchers should also account for extraneous variables such as temperature, developmental stage of worms, and genetic background, which can significantly impact experimental outcomes . A well-designed experiment should include appropriate controls (positive, negative, and genetic background controls) and consider whether a between-subjects or within-subjects design is most appropriate for the specific research question being addressed.

How can single-subject experimental design be applied to srg-1 research in C. elegans?

Single-subject experimental design can be particularly valuable for srg-1 research when studying phenotypic effects that may vary between individual C. elegans. This approach involves using repeated measurements to understand individual variability, which can be crucial when examining subtle phenotypes or when working with limited numbers of transgenic animals . For example, researchers might track behavioral responses in individual worms before and after manipulating srg-1 expression, using each worm as its own control. This approach provides a quantitative, scientifically rigorous framework that can be especially useful in the early stages of characterizing srg-1 function or developing treatments targeting this receptor .

What controls are essential when designing RNAi or CRISPR experiments targeting srg-1?

When designing RNA interference (RNAi) or CRISPR-Cas9 experiments targeting srg-1, several controls are essential. For RNAi experiments, researchers should include:

  • Non-targeting RNAi control (empty vector)

  • RNAi targeting a gene with known phenotype (positive control)

  • Wild-type C. elegans not subjected to RNAi (baseline control)

For CRISPR-Cas9 experiments, essential controls include:

  • Wild-type unedited strains

  • Strains with non-targeting guide RNAs

  • Rescue experiments where the wild-type srg-1 is reintroduced to confirm phenotype specificity

Additionally, researchers should verify knockdown or knockout efficiency through quantitative PCR, Western blotting, or sequencing to ensure that the observed phenotypes correlate with actual changes in srg-1 expression levels .

How can protein-protein interaction studies reveal the signaling partners of srg-1?

Protein-protein interaction studies are crucial for mapping the signaling network of srg-1. Several methodologies can be employed:

  • Yeast two-hybrid screens can identify potential binding partners of srg-1, particularly for cytoplasmic domains

  • Co-immunoprecipitation (Co-IP) experiments can validate interactions in more native conditions

  • Pull-down assays using recombinant His-tagged srg-1 protein can identify direct binding partners

  • Proximity labeling techniques like BioID or APEX can identify proteins in close proximity to srg-1 in living cells

These methods have been successfully applied to other serpentine receptors to elucidate their signaling pathways . When designing these experiments, researchers should consider the membrane-bound nature of srg-1 and the potential challenges in maintaining protein conformation during isolation. The interactions identified should be verified through multiple complementary methods to avoid false positives commonly encountered in protein interaction studies.

What approaches can be used to identify the endogenous ligand for srg-1?

Identifying the endogenous ligand for srg-1 represents a significant research challenge. Several complementary approaches can be implemented:

  • Reverse pharmacology: Screening libraries of candidate molecules (peptides, lipids, or small molecules) for activation of srg-1 signaling

  • Metabolomics: Comparing metabolites between wild-type and srg-1 mutant C. elegans to identify potential ligands

  • Functional assays: Developing reporter systems that measure calcium flux, cAMP production, or other downstream signaling events upon receptor activation

  • Computational approaches: Using homology modeling and molecular docking to predict potential ligand binding sites and candidate ligands

Each approach has advantages and limitations, and a comprehensive strategy often combines multiple methods. Researchers should design experiments with appropriate positive controls, such as known ligand-receptor pairs in C. elegans, to validate their methodological approach .

How can researchers investigate the role of srg-1 in specific C. elegans behaviors?

Investigating the role of srg-1 in C. elegans behaviors requires sophisticated behavioral assays combined with genetic manipulations. Researchers can:

  • Create tissue-specific knockdowns or knockouts of srg-1 to determine where it functions

  • Develop quantitative behavioral assays targeting chemotaxis, thermotaxis, or other sensory behaviors

  • Implement calcium imaging to visualize neural activity in response to potential ligands

  • Use optogenetic or chemogenetic approaches to manipulate srg-1-expressing cells

These experiments should follow a single-subject design when possible, using repeated measurements to understand individual variability in behavioral responses . This approach is particularly valuable when phenotypes may be subtle or variable among individuals. Researchers should carefully control environmental conditions (temperature, humidity, food availability) that might influence the behaviors being studied.

What are the optimal conditions for expressing and purifying recombinant srg-1 protein?

Optimal expression and purification of recombinant srg-1 requires careful consideration of several factors:

ParameterRecommended ConditionsRationale
Expression SystemE. coli (BL21 or Rosetta strains)Balance between yield and cost; supported by commercial availability
Induction Conditions0.5-1.0 mM IPTG, 16-18°C, 16-20 hoursLower temperatures improve folding of membrane proteins
SolubilizationDetergent screening (DDM, LMNG, etc.)Membrane proteins require detergents for stability
Purification MethodNi-NTA affinity chromatographyEfficiently captures His-tagged proteins
Buffer Composition50 mM Tris pH 8.0, 150 mM NaCl, 10% glycerol, 0.02% DDMMaintains protein stability during storage
Quality ControlSDS-PAGE (≥85% purity), Size exclusion chromatographyEnsures protein homogeneity and integrity

Researchers should optimize these conditions empirically for their specific construct and research goals. Membrane proteins like srg-1 present unique challenges, and maintaining their native conformation during purification is critical for functional studies.

What are the most effective approaches for studying srg-1 localization in C. elegans?

To study srg-1 localization in C. elegans, researchers can employ several complementary approaches:

  • Fluorescent protein tagging: Creating transgenic worms expressing srg-1::GFP fusion proteins can reveal the subcellular and tissue-specific localization patterns

  • Immunohistochemistry: Using antibodies against srg-1 or epitope tags for detection in fixed tissues

  • Promoter reporter constructs: Using the srg-1 promoter to drive expression of fluorescent reporters to identify cells expressing srg-1

  • Single-molecule fluorescence in situ hybridization (smFISH): Detecting srg-1 mRNA at the cellular level

Each approach has strengths and limitations. Fluorescent protein tagging may affect protein localization, while immunohistochemistry depends on antibody specificity. Researchers should validate their findings using multiple approaches and include appropriate controls, such as known localization patterns of other serpentine receptors .

How can researchers effectively measure the activation of signaling pathways downstream of srg-1?

Measuring activation of signaling pathways downstream of srg-1 can be accomplished through various approaches:

  • FRET-based sensors: Genetically encoded sensors can detect second messengers (cAMP, calcium) or protein conformational changes in real-time

  • Phosphorylation assays: Western blotting with phospho-specific antibodies to detect activation of downstream kinases

  • Transcriptional reporters: Constructs measuring expression of genes regulated by srg-1 signaling

  • Genetic epistasis experiments: Systematically manipulating components of potential downstream pathways to place srg-1 in a signaling hierarchy

When designing these experiments, researchers should consider the temporal dynamics of signaling and include appropriate positive controls, such as other well-characterized GPCRs in C. elegans. Data from multiple approaches should be integrated to build a comprehensive model of srg-1 signaling pathways .

What statistical approaches are most appropriate for analyzing phenotypic data in srg-1 research?

The statistical approach should match the experimental design used in srg-1 research. For between-subjects designs comparing wild-type and srg-1 mutants, parametric tests like t-tests or ANOVA may be appropriate if assumptions of normality and homogeneity of variance are met . For within-subjects or single-subject experimental designs, repeated measures ANOVA or non-parametric alternatives may be more suitable .

Key considerations include:

  • Sample size planning based on expected effect sizes

  • Testing for normality and other statistical assumptions

  • Appropriate controls for multiple comparisons when testing numerous phenotypes

  • Consideration of potential outliers and their biological significance

  • Visualization approaches that accurately represent the data distribution

Researchers should clearly report all statistical methods, including software used, significance thresholds, and any data transformations performed to ensure reproducibility of findings .

How should researchers interpret seemingly contradictory results in srg-1 functional studies?

When faced with contradictory results in srg-1 studies, researchers should systematically evaluate several factors:

  • Genetic background differences: Different C. elegans strains may harbor genetic modifiers affecting srg-1 function

  • Environmental conditions: Temperature, food quality, or population density can influence phenotypic outcomes

  • Technical variables: Differences in methodologies, reagents, or measurement techniques

  • Biological complexity: srg-1 may have context-dependent functions in different tissues or developmental stages

  • Statistical considerations: Sample size limitations or inappropriate statistical analyses

To resolve contradictions, researchers should design experiments that directly test competing hypotheses, replicate key findings using standardized protocols, and consider collaborative validation in different laboratories . Seemingly contradictory results often ultimately reveal more complex biological realities about the multifaceted roles of proteins like srg-1.

What approaches can be used to integrate srg-1 findings into broader signaling network models?

Integrating srg-1 findings into broader signaling networks requires multidisciplinary approaches:

  • Pathway analysis: Placing srg-1 in the context of known G-protein signaling pathways in C. elegans

  • Network modeling: Using protein-protein interaction data to build network models incorporating srg-1

  • Cross-species comparison: Comparing srg-1 function to related receptors in other organisms

  • Systems biology approaches: Integrating transcriptomics, proteomics, and metabolomics data to build comprehensive models

Researchers should consider the potential for redundancy among serpentine receptors, as the C. elegans genome encodes numerous GPCRs that may have partially overlapping functions. Integration efforts should acknowledge limitations in current knowledge and clearly identify testable predictions generated by the models .

What are common challenges in generating functional recombinant srg-1 protein and how can they be overcome?

Generating functional recombinant srg-1 presents several challenges common to membrane proteins:

ChallengeSolution Strategies
Poor expression levelsOptimize codon usage, use specialized expression strains (Rosetta, C41/C43), test different fusion tags
Inclusion body formationLower induction temperature (16-18°C), reduce IPTG concentration, use solubility-enhancing tags (MBP, SUMO)
Protein instabilityScreen multiple detergents, include stabilizing agents (glycerol, specific lipids), test nanodiscs or other membrane mimetics
Loss of functionVerify proper folding through circular dichroism or limited proteolysis, confirm activity through binding assays
Aggregation during storageOptimize buffer conditions, add stabilizing agents, test protein engineering approaches

Researchers should implement a systematic approach to optimization, testing multiple conditions in parallel and using quality control measures like size exclusion chromatography to assess protein homogeneity .

How can researchers address potential off-target effects in srg-1 knockdown or knockout experiments?

Addressing off-target effects in genetic manipulation experiments requires several complementary approaches:

  • Use multiple RNAi constructs targeting different regions of srg-1 to confirm consistent phenotypes

  • Design CRISPR guide RNAs with minimal predicted off-target sites

  • Perform rescue experiments by reintroducing wild-type srg-1 to confirm phenotype specificity

  • Validate knockdown specificity using qPCR or Western blotting to confirm specific reduction of srg-1

  • Include closely related gene controls (e.g., other srg family members) to test specificity

Researchers should also consider the potential for compensatory mechanisms where other serpentine receptors may functionally compensate for srg-1 loss, potentially masking phenotypes in knockout studies .

What should researchers consider when results from in vitro and in vivo srg-1 studies appear inconsistent?

When facing inconsistencies between in vitro and in vivo studies, researchers should systematically evaluate:

  • Protein conformation differences: In vitro recombinant protein may lack necessary post-translational modifications or proper folding

  • Cellular context: In vivo studies include the complete cellular machinery and signaling networks

  • Environmental factors: Temperature, pH, ionic conditions differ between test tube and cellular environments

  • Temporal dynamics: In vitro studies often capture single time points while in vivo processes are dynamic

  • Concentration differences: Protein concentrations in in vitro experiments may not reflect physiological levels

To reconcile these differences, researchers should develop assays that more closely mirror the in vivo environment, such as reconstituted membrane systems or cell-based assays using C. elegans primary cells. Additionally, comprehensive controls and careful interpretation of limitations for each experimental approach are essential .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.