Recombinant Serpentine receptor class gamma-31 (srg-31)

Shipped with Ice Packs
In Stock

Description

Relationship to Other Serpentine Receptors

Srg-31 is part of a larger family of serpentine receptors in C. elegans, which includes related proteins such as srg-36 and srg-37. These receptor proteins share structural similarities but exhibit distinct functional properties and expression patterns. Research indicates that while srg-36 and srg-37 function as receptors for the ascaroside pheromone ascr#5, srg-31 likely recognizes different molecular signals within the nematode's environment . The structural homology between these receptors suggests evolutionary relationships that have contributed to the diversification of chemosensory mechanisms in nematodes.

Expression Systems

Recombinant srg-31 protein can be produced using various expression systems, with Escherichia coli being the most commonly employed host organism for laboratory-scale production . Alternative expression platforms include yeast, baculovirus-infected insect cells, and mammalian cell culture systems, each offering distinct advantages for protein folding, post-translational modifications, and yield optimization .

The table below summarizes the key features of different expression systems used for recombinant srg-31 production:

Expression SystemAdvantagesConsiderationsTypical Yield
E. coliCost-effective, rapid growth, high yieldLimited post-translational modificationsHigh
YeastProper protein folding, some post-translational modificationsLonger production timeModerate
BaculovirusComplex eukaryotic modifications, suitable for membrane proteinsTechnical complexity, higher costModerate to High
Mammalian CellsNative-like folding and modificationsHighest cost, complex setupLow to Moderate

Purification Methods and Quality Control

The recombinant srg-31 protein, typically featuring an N-terminal His-tag, undergoes purification through affinity chromatography, typically using nickel-charged resins that selectively bind the His-tagged fusion protein . Following initial capture, additional purification steps may include size exclusion chromatography, ion exchange chromatography, or other techniques to achieve high purity.

Quality control measures for recombinant srg-31 include:

  • Purity assessment via SDS-PAGE (typically >90% purity)

  • Western blot analysis to confirm protein identity

  • Mass spectrometry verification of molecular weight and sequence

  • Functional assays to verify biological activity

The final purified protein is typically provided as a lyophilized powder to ensure stability during storage and transportation .

Signaling Mechanisms

As a serpentine receptor, srg-31 likely functions through G protein-coupled signaling pathways, although the specific G proteins and downstream effectors that interact with srg-31 remain to be fully characterized. Based on studies of related serpentine receptors in C. elegans, activation of srg-31 potentially triggers intracellular calcium mobilization, cAMP production, or other second messenger systems that ultimately regulate cellular responses .

Understanding the signaling properties of srg-31 is complicated by the diversity of serpentine receptor functions in nematodes. While some receptors in this class respond to environmental chemicals or pheromones, others may participate in developmental signaling or neuronal function regulation. The specific ligands that activate srg-31 have not been definitively identified, although structural analysis suggests it may respond to small molecule signals similar to other members of the srg family .

Biological Functions

While the precise biological function of srg-31 remains under investigation, research on related serpentine receptors in C. elegans provides insights into its potential roles. The srg-31 gene is expressed in specific neurons in C. elegans, suggesting involvement in sensory perception or neuronal signaling pathways . Unlike its close relatives srg-36 and srg-37, which have been directly implicated in ascaroside pheromone sensing and dauer formation, the specific environmental cues or developmental processes regulated by srg-31 are not yet fully elucidated .

Recent gene expression studies have identified srg-31 among the genes affected during neuronal regeneration processes, suggesting potential involvement in neural development or repair mechanisms . This finding opens new avenues for investigating the function of srg-31 beyond its presumed chemosensory role.

Basic Research Applications

Recombinant srg-31 protein serves as a valuable tool for investigating fundamental aspects of G protein-coupled receptor biology, particularly in the context of chemosensation and nematode physiology. Specific applications include:

  • Structure-function studies to identify critical domains for ligand binding and signaling

  • Development of antibodies for receptor localization and expression studies

  • In vitro binding assays to identify natural and synthetic ligands

  • Comparative studies with other serpentine receptors to understand evolutionary relationships

These basic research applications contribute to our understanding of sensory perception mechanisms in nematodes and may provide insights into the evolution of chemosensory systems across species.

Potential Therapeutic and Biotechnological Applications

While primarily a research tool at present, recombinant srg-31 and knowledge derived from its study hold potential for various applied applications:

  1. Anthelmintic Development: Understanding nematode-specific receptors like srg-31 may facilitate the design of selective anthelmintic compounds targeting parasitic nematodes while minimizing effects on non-target organisms.

  2. Biosensor Development: The ligand-binding properties of srg-31 could potentially be harnessed for the development of biosensors to detect specific environmental chemicals or biological compounds.

  3. Vaccine Research: Recombinant srg-31 is being explored for potential applications in vaccine development, although the specific immunological contexts remain to be fully characterized .

  4. Model System for GPCR Drug Discovery: As a member of the largest receptor family targeted by pharmaceuticals, studies of srg-31 may contribute to general methodologies for GPCR-targeted drug discovery.

Evolutionary Considerations

Genomic analysis of C. elegans strains has revealed interesting patterns of genetic variation in serpentine receptor genes, including evidence of selection and gene flow. For instance, the Tajima's D values across the promoter and coding regions of srg-36 are notably lower than those for srg-37, suggesting stronger purifying selection at srg-36 . Comparative analysis of srg-31 genetic variation across wild strains could provide additional insights into the evolutionary forces shaping chemosensory receptor diversity in nematodes.

Reconstitution and Handling

For experimental use, lyophilized srg-31 requires proper reconstitution:

  1. Brief centrifugation of the vial before opening is recommended to ensure all material is at the bottom

  2. Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Addition of glycerol (typically to a final concentration of 50%) for long-term storage

  4. Aliquoting to minimize freeze-thaw cycles

Proper handling practices ensure maximum retention of protein activity and extend the useful life of the reagent for experimental applications.

Knowledge Gaps

Despite progress in characterizing srg-31 and related serpentine receptors, several knowledge gaps remain:

  1. The natural ligand(s) that activate srg-31 have not been definitively identified

  2. The precise neuronal expression pattern and subcellular localization of srg-31 require further characterization

  3. The specific G proteins and downstream signaling components that couple to srg-31 remain largely unknown

  4. The physiological consequences of srg-31 activation or knockout in C. elegans need further investigation

Future Research Directions

Addressing these knowledge gaps will require multidisciplinary approaches:

  1. Ligand Identification: High-throughput screening of candidate molecules and metabolomics approaches may help identify natural ligands for srg-31.

  2. Functional Genomics: CRISPR-Cas9 genome editing to create precise modifications in srg-31 can help elucidate its biological functions in vivo.

  3. Structural Biology: Determination of the three-dimensional structure of srg-31 would provide insights into ligand binding mechanisms and facilitate structure-based drug design.

  4. Systems Biology: Integration of srg-31 function into broader signaling networks will enhance understanding of its role in nematode physiology and behavior.

  5. Comparative Genomics: Analysis of srg-31 homologs across nematode species may reveal evolutionary patterns and conserved functional domains.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during the production process. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
srg-31; T07H8.5; Serpentine receptor class gamma-31; Protein srg-31
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
srg-31
Target Protein Sequence
MLSSLLITQFIYGTISTIIYSLTVVFLTKNWKHFDNYFLKLYICQFFFNMWMYWNFYITS RLPASTCKDCYLSGWFDSLSKDSGSMFPFKFFIFCQYHLGFMSYSNLFLTSINRFTLIFM PKRYFQIWHYGTYILIALIFITPILFTYPLLVHQAYLEYNPLSDTYVARTQADLPFLYSF ILVWMVVTVLLSIIANIICWFKISKYSKAARQQSDYRLFLVSFVTFVINCGVFSIAMLNK ISADIDPSKLLLSSRIAQLLSPFANDLLSLSTPYVLIIFSKRIRQSIKNLFIKGTVAPSS ITPLQNIPASRI
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_T07H8.5

UniGene: Cel.2403

Protein Families
Nematode receptor-like protein srg family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Serpentine Receptor Class Gamma-31 (srg-31) and what organism is it native to?

Serpentine Receptor Class Gamma-31 (srg-31) is a G protein-coupled receptor (GPCR) native to the nematode Caenorhabditis elegans. The full-length protein consists of 312 amino acids and functions as a transmembrane receptor involved in chemosensation pathways. It belongs to the broader family of serpentine receptors that are characterized by their seven-transmembrane domain structure. In C. elegans, srg-31 is encoded by the srg-31 gene (also designated as T07H8.5) and has been studied for its potential roles in sensory perception and developmental processes .

What are the recommended storage conditions for recombinant srg-31 protein?

For optimal stability and activity preservation of recombinant srg-31, the protein should initially be stored at -20°C or preferably -80°C upon receipt. The lyophilized form provides maximum stability during long-term storage. After reconstitution, working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be strictly avoided as they can significantly compromise protein integrity. For reconstituted samples intended for longer storage, the addition of glycerol to a final concentration of 50% is recommended, followed by aliquoting and storage at -20°C or -80°C. This glycerol concentration serves as a cryoprotectant to minimize structural damage during freezing .

How should srg-31 be reconstituted for experimental use?

The recommended reconstitution protocol for srg-31 involves briefly centrifuging the vial prior to opening to ensure all material is at the bottom. The lyophilized protein should be reconstituted in deionized sterile water to achieve a final concentration of 0.1-1.0 mg/mL. For experiments requiring higher stability, the addition of glycerol to a final concentration of 5-50% is advised. The standard recommendation is 50% glycerol for maximum stability. After reconstitution, the solution should be gently mixed to ensure complete solubilization while avoiding practices that might denature the protein, such as vortexing or extensive pipetting .

What buffer conditions are optimal for maintaining srg-31 stability?

Recombinant srg-31 demonstrates optimal stability in Tris/PBS-based buffers with a pH of approximately 8.0. The addition of 6% trehalose to the buffer formulation serves as a stabilizing agent that helps maintain protein conformation during freeze-thaw cycles and storage. For experimental applications requiring different buffer conditions, researchers should perform gradual buffer exchange using dialysis or size-exclusion chromatography rather than direct dilution into the new buffer system to minimize precipitation risks. When designing experiments, it's crucial to consider that, as a transmembrane protein, srg-31 may exhibit conformational instability in purely aqueous solutions without appropriate additives or detergents .

What techniques can be used to study srg-31 interactions with potential ligands?

Several biophysical and biochemical approaches can be employed to investigate srg-31 interactions with potential ligands. Surface plasmon resonance (SPR) offers real-time, label-free detection of binding kinetics and can be implemented using His-tagged srg-31 immobilized on Ni-NTA sensor chips. Microscale thermophoresis (MST) provides an alternative that requires minimal protein amounts and can detect interactions in near-native conditions. For structural studies, hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map ligand-binding regions by identifying protected areas upon ligand binding. Additionally, computational approaches such as molecular docking and molecular dynamics simulations can predict binding sites and interaction energetics, guiding experimental design. When designing such experiments, it's essential to consider that the His-tag on the recombinant protein might influence binding kinetics, potentially necessitating control experiments with tag-cleaved protein .

How can researchers investigate the function of srg-31 in relation to DPY-31 processing pathways?

Investigating the potential functional relationship between srg-31 and the essential astacin metalloprotease DPY-31 requires a multi-faceted approach. Gene interaction studies in C. elegans can be performed using RNA interference (RNAi) knockdown of srg-31 in wild-type and dpy-31 mutant backgrounds to observe phenotypic changes. Co-immunoprecipitation experiments using antibodies against both proteins can determine if there's direct physical interaction. For in vivo studies, CRISPR-Cas9 genome editing can generate specific mutations in the srg-31 gene to assess effects on DPY-31-dependent pathways, particularly focusing on cuticle formation and embryonic development. Researchers should analyze potential genetic interactions by examining whether alterations in srg-31 expression modify the distinctive phenotypes associated with dpy-31 mutations, such as morphological abnormalities and embryonic lethality .

What are the key considerations for designing experiments to study srg-31 in C. elegans models?

When designing experiments to study srg-31 in C. elegans, researchers should implement comprehensive controls and consider several key factors. First, tissue-specific expression patterns should be verified through reporter gene constructs or immunohistochemistry to confirm hypodermal cell localization, where interaction with cuticle formation pathways may occur. Second, phenotypic analysis should include careful assessment of morphology, movement, and embryonic development, with particular attention to subtle cuticular defects that might indicate functional roles. Third, protein localization studies should examine whether srg-31 colocalizes with known components of secretory pathways or with DPY-31 in the extracellular matrix. Finally, researchers should design rescue experiments using tissue-specific promoters to express wild-type srg-31 in mutant backgrounds, confirming the direct relationship between gene function and observed phenotypes .

How might post-translational modifications affect srg-31 function and interactions?

Post-translational modifications (PTMs) likely play crucial roles in regulating srg-31 function, though specific modifications remain largely uncharacterized. As a G protein-coupled receptor, srg-31 may undergo phosphorylation at serine/threonine residues in its cytoplasmic domains, potentially regulating receptor desensitization and internalization. Potential N-glycosylation sites in the extracellular domains may influence protein folding, stability, and ligand recognition. To investigate these PTMs, researchers should employ mass spectrometry-based proteomics approaches, comparing E. coli-expressed recombinant protein (which lacks most eukaryotic PTMs) with protein isolated from C. elegans. Phosphorylation can be studied using phospho-specific antibodies or phosphatase treatments followed by functional assays. For glycosylation analysis, enzymatic deglycosylation followed by mobility shift assays or lectin binding studies can provide insights into the presence and importance of glycan modifications .

What approaches can address the challenges of structural studies for membrane proteins like srg-31?

Structural studies of membrane proteins like srg-31 present significant technical challenges that require specialized approaches. Cryo-electron microscopy (cryo-EM) has emerged as a powerful technique for membrane protein structure determination without the need for crystallization. This method typically requires protein reconstitution into nanodiscs or amphipol environments to maintain native-like membrane surroundings. Another approach involves X-ray crystallography of protein stabilized in lipidic cubic phase (LCP) or with fusion partners that enhance crystallization propensity. For both methods, protein engineering strategies such as thermostabilizing mutations or removal of flexible regions may be necessary to obtain stable, homogeneous samples. Additionally, nuclear magnetic resonance (NMR) spectroscopy can provide dynamic structural information, particularly for smaller domains or loops of the protein. These structural studies would benefit from comparative modeling using structures of related GPCRs to guide experimental design and data interpretation .

What gene editing approaches are most effective for studying srg-31 function in vivo?

For in vivo functional studies of srg-31, CRISPR-Cas9 genome editing offers the most precise and versatile approach. When designing CRISPR-Cas9 experiments, researchers should target conserved functional domains to maximize phenotypic effects while minimizing off-target modifications. The following table outlines key considerations for different gene editing approaches:

ApproachAdvantagesLimitationsDesign Considerations
CRISPR-Cas9 knockoutComplete gene inactivationMay be lethal if essentialTarget early exons for frameshift mutations
CRISPR-Cas9 knockinPrecise sequence modificationsLower efficiency than knockoutInclude silent mutations in PAM sites to prevent re-cutting
Conditional knockoutsTissue/time-specific analysisMore complex delivery systemUse tissue-specific promoters for Cre expression
RNAiRapid implementation, tunableIncomplete knockdownTarget unique regions to avoid off-target effects
Homologous recombinationTag endogenous proteinLabor intensiveInclude selectable markers for screening

When interpreting results, researchers should carefully distinguish between direct effects of srg-31 modification and potential compensatory mechanisms that may mask phenotypes. Additionally, complementation studies with wild-type srg-31 should be performed to confirm that observed phenotypes are specifically due to srg-31 alterations rather than off-target effects .

What are the key quality control parameters for recombinant srg-31?

Quality control assessment of recombinant srg-31 should include multiple parameters to ensure experimental reliability. Purity should be verified by SDS-PAGE analysis, with the target protein appearing as a predominant band comprising greater than 90% of total protein content. For identity confirmation, Western blotting using anti-His antibodies or, if available, srg-31-specific antibodies should be performed. Protein homogeneity can be assessed through size-exclusion chromatography to detect potential aggregation or degradation products. Biological activity evaluation remains challenging for orphan receptors like srg-31 without known ligands, but structural integrity can be verified through circular dichroism spectroscopy to confirm proper secondary structure content expected for a seven-transmembrane domain protein. For long-term storage stability assessment, aliquots should be analyzed at regular intervals using the same quality control methods to monitor potential degradation over time .

What are common issues encountered when working with recombinant srg-31 and how can they be addressed?

Researchers working with recombinant srg-31 frequently encounter several technical challenges. Protein aggregation is common due to the hydrophobic transmembrane domains, which can be minimized by adding mild detergents like DDM (n-Dodecyl β-D-maltoside) or CHAPS at concentrations slightly above their critical micelle concentration. Low solubility can be addressed by optimizing buffer conditions, particularly by adjusting pH and ionic strength or including stabilizing agents such as glycerol or specific lipids. Degradation during storage can be reduced by adding protease inhibitors and maintaining strict temperature control. When performing binding studies, high background signals may occur due to non-specific interactions with the His-tag; this can be controlled for by including competitive His-peptides or comparing with a control protein carrying the same tag. Additionally, batch-to-batch variability can be managed by implementing standardized quality control procedures and maintaining consistent expression and purification protocols .

How can researchers verify that recombinant srg-31 maintains its native conformation?

Verifying the native conformation of recombinant srg-31 presents a significant challenge, especially given the limited structural information available for this specific protein. Circular dichroism (CD) spectroscopy can provide initial assessment of secondary structure content, which should be consistent with the expected high alpha-helical content characteristic of seven-transmembrane domain proteins. Thermal shift assays can evaluate protein stability under various buffer conditions, with properly folded protein typically showing cooperative unfolding transitions. Limited proteolysis experiments can reveal whether the protein adopts a compact, folded structure resistant to random proteolytic cleavage. For more direct functional validation, researchers can develop binding assays with predicted ligands based on in silico modeling or evolutionary conservation analysis. Additionally, reconstitution into lipid nanodiscs or liposomes followed by electron microscopy can provide visual confirmation of proper membrane integration. These approaches should be used in combination rather than relying on a single method to comprehensively assess conformational integrity .

What is known about the physiological role of srg-31 in C. elegans development?

Current understanding of srg-31's physiological role in C. elegans development remains limited, but several lines of evidence suggest potential functions. As a member of the serpentine receptor class gamma family, srg-31 likely functions in chemosensation pathways, potentially detecting environmental or endogenous chemical signals. The connection to DPY-31, an essential astacin metalloprotease involved in cuticle formation, suggests that srg-31 may participate in developmental signaling pathways related to the extracellular matrix and collagen processing. While direct evidence for embryonic expression patterns is sparse, its possible expression in hypodermal cells could indicate a role in cuticle formation or remodeling during development. Researchers investigating srg-31's developmental functions should examine temporal expression patterns throughout the C. elegans life cycle and assess whether mutations or knockdowns affect specific developmental stages or processes, particularly focusing on potential interactions with the collagen processing machinery .

How does srg-31 relate to DPY-31 and collagen processing pathways?

The relationship between srg-31 and the essential astacin metalloprotease DPY-31 represents a fascinating area for investigation. DPY-31 plays a critical role in C. elegans development by processing the C-terminus of collagen trimers, particularly the SQT-3 collagen. Based on genetic interaction studies, srg-31 may function within this same pathway, potentially as a receptor that regulates DPY-31 activity or localization in response to specific signals. Alternatively, srg-31 could participate in parallel pathways that influence collagen assembly or modification. To elucidate these relationships, researchers should investigate whether srg-31 mutations alter DPY-31 localization, expression, or enzymatic activity. Biochemical approaches can determine if srg-31 directly interacts with DPY-31 or collagens, while genetic approaches can map epistatic relationships between srg-31, dpy-31, and collagen genes like sqt-3. Understanding these interactions could provide significant insights into extracellular matrix formation and remodeling mechanisms relevant to both nematode biology and broader developmental processes .

What are promising future research directions for srg-31 studies?

Several promising research directions could significantly advance our understanding of srg-31 biology. Deorphanization studies to identify the natural ligand(s) of srg-31 would provide crucial insights into its physiological function. This could be approached through candidate ligand screening based on in silico predictions or unbiased metabolomics profiling of C. elegans extracts. Comparative genomics and evolutionary analyses across nematode species could reveal conserved functional domains and potential specialized adaptations. Single-cell transcriptomics of C. elegans at different developmental stages would precisely map srg-31 expression patterns and potentially identify co-expressed genes suggesting functional pathways. Development of biosensors based on srg-31 could enable real-time monitoring of receptor activation in vivo. Additionally, investigating potential roles in human health could be pursued by identifying and characterizing human homologs or related receptors, particularly those that might interact with metalloprotease pathways relevant to extracellular matrix disorders or developmental conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.