Recombinant Serpentine receptor class gamma-3 (srg-3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted per customer needs.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
srg-3; C18F10.6; Serpentine receptor class gamma-3; Protein srg-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-332
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
srg-3
Target Protein Sequence
MSYEHCISGYTNFNENIHYFYQFAYLFTAICINYRILYVIWVSQRHFYRNQSFYNLYSVD CFTSVLAMSNELIFTRSFLYFPQLCVSFSEIVKNSPVFMRIYYCLLSYLIAIKPVIHIFI AVNRMSCVMFPVTYSQNWSQKLRIMLIVIFLAPFLVIWNVLISDNFIGYVNGGFGISYTR RVTWASLSLMQFTLIILTVLITMVTTTVTFYKMTTMKKRIKASERALCIAAALISVGFLL EAITQSFFAFFKEAPWLLDVMNYLRFATMDILFVGSPLVLLLVSDQFRGHVLGSRIGRTQ RVSSINNTHSHIHHNTHHTMTRYSYFLWNVNK
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_C18F10.6

UniGene: Cel.29193

Protein Families
Nematode receptor-like protein srg family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Serpentine receptor class gamma-3 (srg-3)?

Recombinant Serpentine receptor class gamma-3 (srg-3) is a member of the srg class of G protein-coupled receptors found primarily in nematodes, particularly Caenorhabditis elegans. These receptors are characterized by their seven-transmembrane structure and belong to a large nematode-specific family of chemoreceptors that have evolved to detect environmental chemical signals . The srg gene family is distinct from other chemoreceptor families such as the srbc gene family, which has been implicated in sensing different ascaroside pheromones . Recombinant srg-3 refers to the artificially produced version of this receptor for research purposes, typically expressed in heterologous systems such as E. coli, yeast, insect cells, or mammalian cells to facilitate biochemical and functional studies .

What expression systems are suitable for producing Recombinant srg-3?

Based on experiences with similar serpentine receptors, Recombinant srg-3 can be expressed and purified from various host systems, each offering distinct advantages:

  • E. coli: Provides high yields and shorter turnaround times, but typically lacks post-translational modifications necessary for proper GPCR folding and function .

  • Yeast: Offers good yields with relatively short production times while providing some eukaryotic post-translational modifications that may benefit receptor folding .

  • Insect cells with baculovirus: Supports many of the post-translational modifications necessary for correct protein folding, making this system valuable for functional studies .

  • Mammalian cells: Provides the most complete post-translational modifications to retain the protein's activity, though typically with lower yields and longer production times .

  • Cell-free expression systems: Can be used for rapid production of the receptor protein with at least 85% purity as determined by SDS-PAGE, offering advantages for screening studies .

The choice of expression system should be guided by the specific experimental requirements, balancing protein yield, functional integrity, and resource constraints.

How can I assess the quality and purity of Recombinant srg-3 preparations?

The quality and purity of Recombinant srg-3 preparations can be assessed using multiple complementary techniques:

  • SDS-PAGE analysis: Standard commercial preparations typically achieve greater than or equal to 85% purity as determined by SDS-PAGE with Coomassie or silver staining .

  • Western blot analysis: Using antibodies specific to the receptor or to epitope tags incorporated into the recombinant protein to verify identity and integrity.

  • Size exclusion chromatography: To evaluate sample homogeneity and detect the presence of aggregates or oligomeric states.

  • Mass spectrometry: For precise confirmation of protein identity, detection of post-translational modifications, and identification of potential contaminants.

  • Circular dichroism: To assess secondary structure content, providing information about proper folding.

  • Fluorescence-based thermal stability assays: To evaluate protein stability under various buffer conditions and in the presence of potential ligands.

These analytical methods help ensure that experimental results are attributable to the receptor itself rather than contaminants or improperly folded protein species.

Where is srg-3 naturally expressed in C. elegans?

While specific information about srg-3 expression patterns is not directly provided in the search results, insights can be drawn from related receptors. Similar srg family receptors like srg-36 and srg-37 are primarily expressed in the ASI chemosensory neurons, with some weak or inconsistent expression in other neurons . The expression is typically robust during the L1 larval stage when critical developmental decisions such as dauer formation are made . To definitively determine srg-3 expression patterns, researchers typically employ:

  • Transcriptional reporter constructs: Using the srg-3 promoter to drive expression of fluorescent proteins like GFP, allowing visualization of expression patterns in living animals .

  • Translational fusion proteins: Creating fusion proteins that include the entire srg-3 coding sequence tagged with a fluorescent protein to examine both expression pattern and subcellular localization .

  • RNA in situ hybridization: To detect endogenous transcripts in fixed tissues, providing confirmation of gene expression independent of transgenic approaches.

  • Single-cell RNA sequencing: To identify the complete set of neurons expressing srg-3 and quantify expression levels.

These approaches would help identify the specific neurons and developmental stages in which srg-3 is expressed, providing clues to its physiological function.

What is the potential function of srg-3 in C. elegans?

Based on studies of related srg family receptors, srg-3 likely functions as a chemoreceptor involved in sensing environmental cues. Related receptors such as srg-36 and srg-37 have been identified as redundant receptors for specific ascaroside pheromones (particularly ascaroside C3) that regulate dauer formation in C. elegans . The function of srg-3 could include:

  • Detection of specific chemical signals in the environment, potentially including ascarosides or other pheromones that regulate behavior or development .

  • Regulation of developmental decisions such as dauer formation, which is a stress-resistant alternative developmental stage induced under unfavorable environmental conditions .

  • Mediation of behavioral responses such as chemotaxis, avoidance, or social behaviors that are critical for survival and reproduction.

  • Potential roles in sensing food-related cues, as many chemoreceptors in C. elegans are involved in food detection and foraging behaviors.

Functional studies involving genetic knockout, overexpression, or heterologous expression would be necessary to definitively establish the specific ligands and biological roles of srg-3.

What are the optimal conditions for folding and stability of Recombinant srg-3?

The folding and stability of Recombinant srg-3, as with other GPCRs, present significant challenges in experimental settings. Based on insights from related receptors:

  • Membrane environment: GPCRs require a suitable membrane environment for proper folding. This can be provided by expressing the protein in eukaryotic systems (especially insect or mammalian cells) that offer appropriate membrane composition and folding machinery .

  • Post-translational modifications: These are often crucial for correct folding and function. Expression systems that provide appropriate post-translational modifications (glycosylation, disulfide bond formation) should be preferred .

  • Structural considerations: The highly conserved proline residue in transmembrane segment VI, which is known to be important for folding GPCRs into their native, inactive conformations, should be maintained to prevent constitutive activity and misfolding .

  • Detergent selection: For extraction and purification, detergents must be carefully selected to maintain the receptor's structural integrity. Mild detergents like DDM (n-Dodecyl β-D-maltoside) or LMNG (Lauryl Maltose Neopentyl Glycol) are often suitable.

  • Stabilizing agents: Addition of cholesterol, specific lipids, or ligands can enhance stability during purification and storage by stabilizing specific conformational states.

Quality control mechanisms that operate in cells typically ensure receptors fold into their native, fully inactive conformations before reaching the cell surface, which prevents inappropriate signaling in the absence of ligand .

How can I identify potential ligands for srg-3?

Identifying ligands for orphan receptors like srg-3 requires systematic approaches:

  • Heterologous expression system: Express srg-3 in a system that allows for functional coupling to downstream signaling (e.g., mammalian cells with appropriate G protein subunits or yeast-based systems) .

  • Gain-of-function experiments: Similar to work with srg-36 and srg-37, express srg-3 in sensory neurons that mediate specific behaviors (e.g., ASH neurons that direct avoidance behaviors) and test if this confers novel responsiveness to potential ligands . This approach successfully demonstrated that srg-36 and srg-37 function as receptors for ascaroside C3 .

  • Candidate approach: Test structurally related compounds to known ligands of other srg family receptors, particularly ascarosides with various side chains, as these molecules serve as important pheromones in C. elegans .

  • Deorphanization screens: Screen libraries of natural C. elegans metabolites or synthetic compound libraries using functional assays such as calcium imaging, cAMP accumulation, or arrestin recruitment.

  • Genetic approaches: Analyze phenotypes of srg-3 mutants in response to various chemical cues, looking for specific deficits in chemosensory behaviors.

These approaches can be used in combination to maximize the chances of identifying physiologically relevant ligands for srg-3.

What methods can be used to study the signaling pathways downstream of srg-3 activation?

Studying downstream signaling of srg-3 requires methods that can detect G protein activation and subsequent cellular responses:

  • GPCR-G protein coupling assays:

    • BRET or FRET assays to measure receptor-G protein interactions in real-time

    • [35S]GTPγS binding assays to detect G protein activation biochemically

    • G protein dissociation assays that monitor subunit separation upon activation

  • Second messenger assays:

    • cAMP measurements if coupled to Gαs or Gαi proteins

    • Ca2+ flux measurements using fluorescent indicators if coupled to Gαq

    • Measurement of inositol phosphates to detect phospholipase C activation

  • In vivo approaches in C. elegans:

    • Genetic epistasis experiments with known signaling components

    • Ca2+ imaging in neurons expressing srg-3 using genetically encoded calcium indicators

    • Behavioral assays as functional readouts of receptor activation

  • Transcriptional responses:

    • Analyze changes in gene expression following receptor activation

    • Use transcriptional reporters in C. elegans that respond to specific signaling pathways

These approaches could help determine which G protein subunits couple to srg-3 and what downstream effectors are engaged upon receptor activation, providing insights into the physiological consequences of receptor stimulation.

What are the structural determinants of ligand specificity in srg-3 compared to other srg family members?

Understanding ligand specificity requires comparative analysis of receptor structures:

  • Sequence alignment analysis: Compare the transmembrane domains and potential binding pockets of srg-3 with other srg family members with known ligands, focusing on regions of sequence divergence that might confer differential ligand specificity .

  • Homology modeling: Generate structural models based on crystallized GPCRs, particularly those with resolved ligand-binding domains, to predict the three-dimensional arrangement of the binding pocket.

  • Site-directed mutagenesis approaches:

    • Alanine scanning of potential binding pocket residues to identify critical interaction points

    • Construction of chimeric receptors between srg-3 and related receptors with known ligands to map ligand-binding domains

    • Point mutations of divergent residues between family members to alter ligand specificity

  • Molecular dynamics simulations: Model ligand docking and binding energy calculations to predict critical interaction points and conformational changes associated with receptor activation.

The rapid evolution of chemoreceptors between species suggests that studying srg-3 orthologs in related nematode species could also provide insights into functionally important regions and evolutionary adaptation of ligand specificity .

How does the trafficking of srg-3 compare to constitutively active GPCR mutants?

GPCR trafficking is critical for proper function and regulation. Based on studies of yeast pheromone receptors and other GPCRs:

  • Normal trafficking pathway: Wild-type GPCRs are typically inserted into the ER membrane, folded into their native inactive conformations, and transported through the secretory pathway to the cell surface where they can be activated by ligands .

  • Constitutively active mutants: These often accumulate in post-ER compartments rather than at the cell surface, suggesting that quality control mechanisms may retain receptors with non-native conformations . This contrasts with other defective membrane proteins, which are typically targeted to the vacuole by default .

  • Research approaches to study srg-3 trafficking:

    • Fluorescent protein tagging to visualize receptor localization in living cells

    • Cell surface biotinylation assays to quantify plasma membrane expression

    • Endoglycosidase H sensitivity assays to distinguish ER vs. post-ER localization

    • Colocalization studies with compartment-specific markers to identify retention sites

  • Impact of mutations: Mutations in conserved residues, particularly the conserved proline in transmembrane domain VI, may affect both signaling and trafficking behaviors by altering receptor conformation .

Understanding these trafficking mechanisms is important because they ensure that receptors do not trigger inappropriate responses in the absence of ligand, providing an additional layer of regulation beyond the intrinsic conformational stability of the inactive state .

What are the optimal methods for generating knockout or mutant srg-3 strains in C. elegans?

For generating srg-3 mutants in C. elegans, several approaches can be employed:

  • CRISPR/Cas9 genome editing:

    • Design guide RNAs targeting the srg-3 coding sequence with minimal off-target effects

    • Include repair templates for precise modifications such as deletions or point mutations

    • Screen for mutations using PCR and sequencing to identify successful edits

    • Back-cross to wild-type animals to eliminate potential off-target mutations

  • Deletion mutant screening:

    • Use nested PCR screening of mutagenized populations to identify deletions in the srg-3 gene

    • Sequence deletion breakpoints to characterize the molecular nature of the mutation

    • Back-cross multiple times to remove background mutations from chemical mutagenesis

  • Transposon-based approaches:

    • Screen existing Tc1/Mos1 insertion libraries for disruptions in or near srg-3

    • Use transposon excision to generate imprecise repairs and deletions in the gene

    • Characterize the resulting alleles by molecular analysis and functional assays

  • RNAi knockdown:

    • While not a genetic mutant, RNAi can provide rapid assessment of gene function

    • Design dsRNA targeting srg-3 specifically, avoiding cross-reactivity with other srg family members

    • Deliver via feeding, soaking, or injection methods, optimizing for neurons if necessary

For functional studies, it's often valuable to create multiple alleles including null mutations, missense mutations in key functional domains, and GFP or epitope tag insertions for localization studies.

What expression systems provide the best yield and functionality for Recombinant srg-3?

Based on data from similar receptors, the following expression systems offer different advantages for Recombinant srg-3 production:

Expression SystemTypical YieldPost-translational ModificationsTurnaround TimeFunctional ActivityBest Applications
E. coliHighMinimalShort (days)Low to moderateStructural studies, antibody production
YeastModerate-highPartialModerateModerateBalance of yield and function
Insect cellsModerateNear-completeModerate-longGoodFunctional studies, ligand screening
Mammalian cellsLow-moderateCompleteLong (weeks)ExcellentPhysiological signaling studies
Cell-freeVariableDependent on systemVery shortVariableRapid screening, protein engineering

For structural studies where high yield is critical, E. coli or yeast systems may be preferable . For functional studies requiring proper folding and activity, insect or mammalian cell systems typically provide better results despite lower yields . The choice should be guided by the specific experimental requirements and downstream applications.

How can I determine if srg-3 is functionally active after recombinant expression?

Verifying functional activity of Recombinant srg-3 requires assays that can detect ligand binding and downstream signaling:

  • Ligand binding assays:

    • Radioligand binding if a labeled ligand is available

    • Fluorescence-based binding assays with labeled ligands

    • Surface plasmon resonance (SPR) or microscale thermophoresis (MST) for label-free binding measurements

  • Functional coupling assays:

    • G protein activation assays (GTPγS binding)

    • Second messenger production (cAMP, Ca2+, IP3)

    • Arrestin recruitment assays using BRET or enzyme complementation

    • Conformational change detection using BRET/FRET sensors

  • Heterologous expression functional assays:

    • Express srg-3 in neurons that mediate specific behaviors (e.g., ASH neurons) and test for novel responses to potential ligands, similar to the approach used for srg-36 and srg-37

    • Express in yeast or mammalian reporter cell lines with pathway-specific readouts

  • Electrophysiological measurements:

    • Patch-clamp recordings to detect changes in membrane potential or currents following ligand application

    • Two-electrode voltage clamp in Xenopus oocytes expressing the receptor

For GPCRs like srg-3 where the natural ligand may be unknown, developing a reliable activity assay may require first identifying the ligand through deorphanization screens.

What approaches can be used to study potential redundancy between srg-3 and other chemoreceptors?

Functional redundancy among chemoreceptors is common in C. elegans, as demonstrated with srg-36 and srg-37, which are redundant receptors for ascaroside C3 . To study potential redundancy:

  • Genetic approaches:

    • Generate single and combination knockout mutants of srg-3 and related receptors

    • Quantitative phenotypic analysis (e.g., chemotaxis, dauer formation) to detect partial or complete redundancy

    • Transgenic rescue experiments with individual receptors to determine functional equivalence

  • Expression pattern analysis:

    • Determine if srg-3 is co-expressed with other receptors in the same neurons

    • Analyze temporal expression patterns during development to identify potential functional overlap

    • Use double-labeling techniques to directly visualize co-expression

  • Gain-of-function studies:

    • Express individual receptors in cells that don't normally express them

    • Test if this confers novel sensory capabilities or rescues mutant phenotypes

    • Compare responses to candidate ligands between different receptors

  • Molecular evolution analysis:

    • Examine patterns of gene duplication and sequence conservation

    • Identify cases where gene loss in certain species is compensated by related receptors

    • Analyze selective pressure on different receptor family members

The observation that either srg-36 or srg-37 can support dauer formation in response to ascaroside C3 provides a model for studying such redundancy and suggests that similar mechanisms might exist for srg-3 and related receptors .

How should I interpret apparent contradictions between in vitro and in vivo studies of srg-3 function?

Discrepancies between in vitro and in vivo findings are common in receptor biology and require careful analysis:

  • Common causes of contradictions:

    • Absence of necessary cofactors or interacting proteins in simplified systems

    • Differences in post-translational modifications between expression systems

    • Altered membrane lipid composition affecting receptor conformation and function

    • Expression levels differing from physiological conditions

    • Potential for receptor homo- or heterodimerization in vivo that is not recapitulated in vitro

  • Resolution approaches:

    • Systematically add complexity to in vitro systems (add interacting proteins, appropriate lipids)

    • Create intermediate complexity systems (primary cell cultures, organoids)

    • Develop more sophisticated in vivo analysis methods to isolate specific cellular responses

    • Use genetic approaches to test specific hypotheses about mechanistic differences

  • Interpretation framework:

    • Consider what each system is optimized to measure (binding vs. signaling vs. physiological outcome)

    • Evaluate the timescale of measurements (acute vs. chronic effects)

    • Assess the presence of compensatory mechanisms in in vivo systems

Studies with other C. elegans chemoreceptors have shown that receptor function in vivo can differ from in vitro characterization, suggesting that additional factors contribute to ligand specificity and signaling in the native context .

What are the most common pitfalls in experimental design when working with Recombinant srg-3, and how can they be avoided?

Working with recombinant GPCRs presents several challenges that should be anticipated:

  • Expression level issues:

    • Pitfall: Over-expression leading to aggregation or constitutive activity

    • Solution: Use inducible expression systems and optimize induction conditions to achieve physiological expression levels

  • Protein purity concerns:

    • Pitfall: Contamination with host cell proteins affecting functional assays

    • Solution: Implement multi-step purification protocols and verify purity by multiple methods including SDS-PAGE, size exclusion chromatography, and mass spectrometry

  • Functional state preservation:

    • Pitfall: Loss of activity during purification or storage

    • Solution: Optimize detergent choice, include stabilizing ligands, and test activity at each purification step

  • Ligand identification challenges:

    • Pitfall: False positives in binding or activation assays

    • Solution: Include proper controls, validate with multiple assay types, and confirm dose-dependency of responses

  • Specificity determination:

    • Pitfall: Assuming the receptor responds to only one ligand

    • Solution: Test structurally related compounds and physiologically relevant mixtures to assess specificity

  • Heterologous system limitations:

    • Pitfall: Missing essential cofactors present in native neurons

    • Solution: Co-express potential interacting partners or use more native-like cells for functional studies

Careful experimental design with appropriate controls and validation across multiple systems can help avoid these common pitfalls and produce more reliable and physiologically relevant results.

How can I distinguish between direct and indirect effects when studying srg-3 signaling in C. elegans?

Distinguishing direct and indirect signaling effects requires multiple complementary approaches:

  • Temporal resolution:

    • Measure responses at multiple time points after stimulation

    • Direct effects typically occur rapidly (seconds to minutes) while indirect effects take longer

    • Use optogenetic or chemical genetic tools for precise temporal control of receptor activation

  • Cell-specific manipulation:

    • Express srg-3 only in specific neurons and observe resulting phenotypes

    • Use cell-specific rescue of srg-3 in mutant backgrounds to determine where expression is sufficient

    • Employ cell-specific inhibition of downstream pathway components to block transmission

  • Ex vivo approaches:

    • Isolate and culture neurons expressing srg-3

    • Perform calcium imaging or electrophysiology with direct ligand application

    • Compare responses in isolated cells vs. intact animals to identify network effects

  • Biochemical validation:

    • Demonstrate direct binding of ligands to purified receptor

    • Show receptor-dependent activation of immediate downstream effectors (G proteins)

    • Use proximity labeling techniques to identify direct interactors in the native context

These approaches can help establish direct causality between receptor activation and observed phenotypes, distinguishing between primary signaling events and secondary consequences.

What emerging technologies might advance our understanding of srg-3 function and regulation?

Several cutting-edge technologies could significantly enhance srg-3 research:

  • Cryo-EM for structural studies:

    • Determine high-resolution structures of srg-3 in different conformational states

    • Visualize receptor-ligand and receptor-G protein complexes

    • Identify structural changes during activation that could inform drug design

  • Single-molecule techniques:

    • FRET-based sensors to detect conformational changes in real-time

    • Single-molecule tracking to monitor receptor dynamics in live cells

    • Force measurements of ligand binding and protein conformational changes

  • Genomic engineering:

    • CRISPR-based precise genome editing for endogenous tagging of srg-3

    • CRISPR activation/inhibition for controlled expression in specific cells

    • Base or prime editing for introducing specific mutations with minimal disruption

  • Advanced imaging:

    • Super-resolution microscopy to visualize receptor clustering and trafficking

    • Whole-brain calcium imaging in C. elegans during chemosensation

    • Correlative light and electron microscopy to connect function with ultrastructure

  • Computational approaches:

    • Molecular dynamics simulations of ligand binding and conformational changes

    • Machine learning to predict ligand-receptor interactions

    • Systems biology modeling of signaling networks downstream of receptor activation

These technologies could help resolve outstanding questions about srg-3 function, regulation, and its role in C. elegans biology, potentially leading to new insights into GPCR function across species.

How might evolutionary analysis of srg family receptors inform our understanding of srg-3 function?

Evolutionary analysis provides valuable insights into receptor function:

  • Comparative genomics approaches:

    • Identify orthologous srg-3 receptors across nematode species

    • Map conservation patterns to infer functionally important domains

    • Detect signatures of positive selection suggesting ligand-interaction regions

  • Gene family expansion analysis:

    • Study patterns of gene duplication and diversification within the srg family

    • Correlate receptor diversification with ecological niches or behaviors

    • Examine cases of gene loss or pseudogenization that might reveal functional redundancy

  • Experimental evolutionary studies:

    • Compare ligand specificities of srg-3 orthologs from different species

    • Reconstruct ancestral receptors to trace functional evolution

    • Create chimeric receptors to map functional domains

The rapid evolution observed in chemoreceptor gene families, with only half of receptors showing one-to-one orthology between C. elegans and C. briggsae, suggests ongoing adaptation to changing chemical environments . Similar analysis of srg-3 could reveal its evolutionary trajectory and functional specialization. The parallel evolution observed in srg-36 and srg-37, where independent deletion events occurred in different laboratory strains of C. elegans, highlights the adaptive significance of these receptors .

What are the potential applications of understanding srg-3 function for nematode control or evolutionary biology?

Understanding srg-3 function could have broader implications:

  • Agricultural pest management:

    • Design species-specific attractants or repellents targeting srg receptors

    • Develop compounds that disrupt critical chemosensory behaviors

    • Create traps or monitoring systems based on chemosensory preferences

  • Parasitic nematode control:

    • Identify conserved chemoreceptor mechanisms in parasitic species

    • Target host-finding or developmental transition behaviors

    • Develop receptor antagonists as novel anthelmintics with minimal off-target effects

  • Evolutionary biology insights:

    • Map chemoreceptor evolution to changing ecological niches

    • Understand the genetic basis of chemosensory adaptation

    • Study how sensory systems evolve during speciation and domestication

  • Fundamental biology applications:

    • Use srg receptors as models for understanding GPCR evolution and diversity

    • Study the relationship between receptor structure and ligand specificity

    • Explore mechanisms of signal integration in complex sensory networks

The domestication of C. elegans in laboratory settings has already led to adaptation through changes in chemoreceptor genes , highlighting their importance in environmental adaptation. Similar principles may apply to the evolution of chemoreception in other organisms, including insects and vertebrates.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.