Recombinant Serpentine receptor class gamma-46 (srg-46)

Shipped with Ice Packs
In Stock

Description

Production and Purification

SRG-46 is typically produced via recombinant expression in E. coli systems . Key production parameters include:

ParameterSpecification
Expression HostEscherichia coli
TagN-terminal His tag
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0) .
Reconstitution0.1–1.0 mg/mL in sterile water; 50% glycerol recommended for stability .

Role in Chemosensation

SRG-46 belongs to the serpentine receptor class gamma, which in C. elegans regulates responses to environmental cues. Related receptors (e.g., SRG-36, SRG-37) are implicated in dauer formation and chemosensory behavior . SRG-46 likely shares functional parallels, though direct ligand interactions remain uncharacterized .

GPCR Activation Dynamics

Studies on GPCRs in yeast and mammals highlight conserved proline residues in transmembrane domain VI (e.g., Pro-258 in α-factor receptors) as critical for receptor activation and trafficking . While SRG-46’s activation mechanism is unstudied, structural homology suggests similar regulatory motifs .

Applications in Research

ApplicationUtility
Structural StudiesUsed in SDS-PAGE and crystallization trials to map GPCR architecture .
Ligand ScreeningPotential tool for identifying novel ligands via binding assays .
Signal Transduction StudiesFacilitates analysis of G protein coupling in invertebrate models .

Comparative Analysis of Related Proteins

ProteinSpeciesFunctionExpression Site
SRG-46C. elegansPutative chemosensory receptorASI neurons (inferred)
SRG-36/37C. elegansMediates dauer formation via C3 ascaroside detectionASI neurons
STE3 (a-factor receptor)S. cerevisiaePheromone response and matingCell membrane

Challenges and Future Directions

  • Functional Characterization: SRG-46’s exact ligands and downstream signaling partners are unknown .

  • Therapeutic Potential: GPCRs are drug targets; SRG-46 could model parasitic nematode receptors for antiparasitic drug discovery .

  • Structural Resolution: High-resolution cryo-EM or X-ray crystallography studies are needed to elucidate activation mechanisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format requirement, please indicate it in your order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
srg-46; F32H5.5; Serpentine receptor class gamma-46; Protein srg-46
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
srg-46
Target Protein Sequence
MTVLMLIWMSYGPISIALSVVIFCILAVSLKFKSIFYRIVQFDILMNTVFYVNCITYKLK TIEEYHRVLLLIFESYPSLFILREGLSFWAYRFQCSSLLLKCIFRFTYAKYPFAAEIWKK HYRLIMVSTIFYSILLTIPFVFITKEHHGFDYYAFTMNIETVIYLLLTIYLGRLTKLSLK KRSKRFAESIKKLNNYIYCDLFIHGVAFFGVMIPKMLSFEWTEETKDYILTFTVDAINLA STYIIIICDSNLRKILFCHTKKLTTSVFQVSAVPVSKLIVSPQ
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_F32H5.5

UniGene: Cel.26672

Protein Families
Nematode receptor-like protein srg family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Serpentine Receptor Class Gamma-46 (srg-46)?

Serpentine receptor class gamma-46 (srg-46) is a member of the G protein-coupled receptor (GPCR) superfamily expressed in Caenorhabditis elegans. Like other GPCRs, it features seven transmembrane domains and is involved in signal transduction. The "recombinant" designation indicates protein produced through genetic engineering techniques rather than directly isolated from the organism. GPCRs constitute the most abundant network of ligand-receptor-mediated signaling in humans and other organisms .

In C. elegans specifically, chemosensory GPCRs like srg-46 are typically involved in detecting environmental chemical cues, which may include food sources, predators, or mating partners. As a member of the serpentine receptor gamma class, srg-46 likely functions in chemosensation, though its specific ligands and precise physiological roles remain to be fully characterized. Understanding this receptor requires consideration of both its molecular structure and its role in the organism's sensory systems.

How does srg-46 compare structurally to other characterized GPCRs?

Structurally, srg-46 shares the canonical seven-transmembrane domain architecture characteristic of class A (rhodopsin-like) GPCRs. While specific structural information for srg-46 has not been fully elucidated, comparative analysis with related receptors provides valuable insights. Class A GPCRs typically feature highly conserved motifs including the E/DRY motif in the third transmembrane domain and the NPxxY motif in the seventh transmembrane domain, which are crucial for G protein coupling and receptor activation.

The extracellular loops and N-terminal domain of srg-46 likely contain regions responsible for ligand recognition and binding specificity, while intracellular loops and the C-terminal domain would mediate interactions with G proteins and other downstream signaling molecules. These structural features are highly conserved across species, reflecting evolutionary pressure to maintain distinct physiological functions of receptors compared to their ligands . Detailed structural characterization through homology modeling, based on crystal structures of related GPCRs, can provide preliminary insights into srg-46's binding pocket and potential activation mechanisms.

What signaling pathways are typically associated with serpentine receptors like srg-46?

Serpentine receptors like srg-46 typically couple to various G protein subtypes that trigger distinct intracellular signaling cascades. Based on studies of related receptors, srg-46 may signal through multiple pathways including:

  • Gαs pathway: Activating adenylyl cyclase to increase intracellular cAMP

  • Gαi/o pathway: Inhibiting adenylyl cyclase to decrease cAMP levels

  • Gαq/11 pathway: Stimulating phospholipase C to generate IP3 and DAG

  • Gα12/13 pathway: Regulating Rho GTPases and cytoskeletal reorganization

Additionally, srg-46 likely engages β-arrestin-dependent pathways that mediate receptor desensitization, internalization, and potentially alternative signaling cascades. The specific G protein coupling profile for srg-46 remains to be experimentally determined, as orphan GPCRs typically have uncharacterized signaling pathways . Receptor activity can be measured using various assays that monitor different aspects of GPCR activation, including cAMP accumulation, calcium mobilization, and β-arrestin recruitment. Comprehensive characterization requires multiple complementary assays to account for potential signaling bias and to avoid missing bona fide receptor-ligand interactions .

What expression systems are recommended for recombinant production of srg-46?

For successful recombinant production of srg-46, several expression systems can be employed, each with distinct advantages depending on research objectives:

  • Mammalian Cell Systems:

    • HEK293 and CHO cells provide proper folding and post-translational modifications

    • Enable functional coupling to mammalian G proteins for signaling studies

    • Most suitable for functional characterization and high-throughput screening

    • Recommended vector elements include strong promoters (CMV/EF1α) and epitope tags for detection

  • Insect Cell Systems:

    • Sf9 or High Five cells with baculovirus vectors yield higher protein quantities

    • Properly process membrane proteins for structural studies

    • Better suited when larger amounts of properly folded protein are needed

    • Allow scale-up in suspension cultures for purification purposes

  • Yeast Expression Systems:

    • Pichia pastoris combines eukaryotic processing with high expression levels

    • Cost-effective for large-scale production

    • Particularly useful for isotope labeling for NMR studies

  • C. elegans Expression:

    • Provides native cellular environment with appropriate processing machinery

    • Enables in vivo functional studies in the receptor's natural context

    • Typically uses transgenic approaches with tissue-specific promoters

Expression optimization strategies include codon optimization for the host system, addition of N-terminal signal sequences, temperature modulation during expression (typically 30°C instead of 37°C), and inclusion of chemical chaperones like DMSO or glycerol to improve folding efficiency. Verification of proper expression should include surface localization studies using confocal microscopy or surface biotinylation assays .

What are the most effective approaches for identifying potential ligands for orphan receptors like srg-46?

Identifying ligands for orphan receptors like srg-46 requires a systematic deorphanization strategy combining computational prediction with experimental validation:

  • Computational Prediction Methods:

    • Evolutionary analysis across species to identify conserved binding domains

    • Homology modeling based on related receptors with known ligands

    • Molecular docking simulations with virtual compound libraries

    • Examination of coevolution between receptors and potential ligand precursors

  • Candidate Library Creation:

    • Design peptide libraries based on predicted endogenous ligands

    • Include various cleavage variants with post-translational modifications

    • Incorporate disulfide bridges and C-terminal amidation where appropriate

    • Consider bioactive molecules from the receptor's native environment

  • Primary Screening Methods:

    • Dynamic mass redistribution assay to capture most signaling pathways

    • Receptor internalization assay for pathway-independent activation assessment

    • β-arrestin recruitment assay for increased sensitivity in detecting interactions

    • Label-free impedance-based assays for integrated cellular responses

  • Validation and Characterization:

    • Concentration-response curves to determine potency (EC50)

    • Specificity testing against related receptors

    • Multiple orthogonal assays to account for signaling bias

    • Structure-activity relationship studies with ligand derivatives

This multifaceted approach is crucial as GPCRs can couple to multiple signaling pathways, and responses can vary depending on the signal pathway, cell type, and assay timeframe investigated . The literature emphasizes that using multiple complementary orthogonal assay platforms provides the best coverage of potential signaling mechanisms and reduces the risk of missing genuine ligand-receptor interactions.

How can CRISPR-Cas9 gene editing be optimized for studying srg-46 function in C. elegans?

CRISPR-Cas9 gene editing offers powerful approaches for investigating srg-46 function in its native context. The following methodological recommendations optimize success rates and experimental utility:

  • Strategic Guide RNA Design:

    • Design multiple sgRNAs targeting conserved regions of srg-46

    • Confirm specificity using BLAST to avoid off-target effects

    • Select target sites near the start codon for knockout studies

    • For knock-in studies, select sites near the desired modification location

    • Optimize sgRNA efficiency using validated prediction algorithms

  • Repair Template Optimization:

    • For knockouts: Consider using template-free editing for small indels

    • For knock-ins: Include 500-1000bp homology arms flanking the insertion site

    • For fluorescent tagging: Ensure the tag does not disrupt critical domains

    • Include silent mutations in the PAM site to prevent re-cutting of edited DNA

    • Consider using antibiotic selection markers for enrichment of edited animals

  • Delivery Methods:

    • Microinjection of young adult hermaphrodites with:

      • Purified Cas9 protein (more efficient than Cas9-encoding plasmids)

      • In vitro transcribed sgRNAs

      • Repair template DNA

    • Co-injection markers (fluorescent proteins) to identify transgenic animals

    • Alternative approaches include electroporation for batch editing

  • Screening and Validation Strategies:

    • PCR-based genotyping with primers flanking the edit site

    • Restriction digest screening if the edit creates/removes restriction sites

    • Sequencing verification of all isolated lines

    • Phenotypic characterization (behavior, development, lifespan)

    • Expression analysis using RT-qPCR or Western blotting

  • Functional Analysis Applications:

    • Generate complete knockouts to study loss-of-function phenotypes

    • Create precise point mutations to study structure-function relationships

    • Engineer conditional alleles using auxin-inducible degradation systems

    • Insert fluorescent tags for localization and trafficking studies

    • Implement cell-specific rescue experiments to determine site of action

This comprehensive approach enables precise genetic manipulation of srg-46, facilitating detailed investigation of its physiological roles in chemosensation, development, and other potential functions in C. elegans.

How can researchers address potential biases in GPCR signaling assays when studying srg-46?

When studying GPCRs like srg-46, researchers must account for several sources of bias that can significantly impact experimental outcomes and interpretations:

  • Assay-Dependent Observational Bias:
    Different assay platforms often yield varying results due to their inherent sensitivities to specific signaling pathways. This is especially problematic for orphan receptors with poorly characterized signaling pathways . To address this, researchers should employ multiple orthogonal assays covering different aspects of GPCR activation, including G protein-dependent and independent pathways. Time-resolved measurements are particularly valuable as they provide insights into receptor signaling kinetics that might be missed in endpoint assays.

  • Ligand-Mediated Signal Bias:
    Ligands can intrinsically favor specific receptor conformations that preferentially activate certain pathways over others. This phenomenon, known as biased agonism, means that a ligand's activity profile can differ dramatically depending on which downstream pathway is being measured . Researchers should characterize ligand activity across multiple signaling endpoints (various G protein subtypes, β-arrestin recruitment) and calculate bias factors using appropriate mathematical models (e.g., operational model of bias).

  • Expression Level Artifacts:
    Overexpression systems may show constitutive activity or coupling to non-physiological pathways that wouldn't occur at endogenous expression levels. To mitigate this, use inducible expression systems to titrate receptor levels, validate findings at lower expression levels, and ultimately confirm results in native systems where possible. Quantitative comparison of receptor expression between recombinant systems and native tissues provides important context for interpreting results.

  • Cellular Context Variations:
    The complement of signaling proteins varies between cell types, affecting the observed responses to receptor activation. Testing in multiple cell backgrounds and validating key findings in the native cellular context can address this issue. Additionally, reconstitution experiments adding specific signaling components can help identify required partners for particular pathways.

What are the recommended methods for characterizing srg-46 expression patterns in C. elegans?

Comprehensive characterization of srg-46 expression patterns requires complementary approaches to provide both spatial and temporal information:

  • Transcriptional Reporter Analysis:

    • Generate transgenic lines expressing fluorescent proteins (GFP/mCherry) under the srg-46 promoter

    • Image using confocal microscopy to identify expressing cells

    • Perform co-localization studies with established neuronal markers

    • Examine expression across developmental stages from embryo to adult

    • Test effects of various environmental conditions on expression patterns

  • Translational Fusion Approach:

    • Create full-length srg-46::GFP fusion constructs to visualize protein localization

    • Use CRISPR/Cas9 to tag the endogenous locus for native expression levels

    • Employ spinning disk confocal microscopy for dynamic trafficking studies

    • Analyze subcellular localization in dendrites, cilia, and cell bodies

    • Examine potential redistribution following exposure to chemical stimuli

  • Single-Cell Transcriptomics:

    • Isolate specific neuron types using fluorescence-activated cell sorting

    • Perform single-cell RNA sequencing to quantify expression levels

    • Create comprehensive expression atlases across developmental stages

    • Compare expression with related receptor genes and signaling components

    • Identify co-expressed genes that may function in the same pathway

  • Antibody-Based Methods:

    • Develop specific antibodies against srg-46 for immunohistochemistry

    • Use epitope-tagged versions for detection with commercial antibodies

    • Perform Western blotting to quantify expression levels

    • Employ immunoelectron microscopy for precise subcellular localization

    • Combine with proximity labeling techniques to identify interacting proteins

TechniqueResolutionQuantifiableLive ImagingSpecial Considerations
Promoter::GFPCellularYesYesMay not reflect post-transcriptional regulation
CRISPR Knock-inEndogenousYesYesMost physiologically relevant but technically challenging
scRNA-seqSingle-cellHighlyNoProvides comprehensive transcriptional context
ImmunostainingSubcellularSemiNoDependent on antibody specificity

These complementary approaches collectively provide a comprehensive view of srg-46 expression, enabling correlation between expression patterns and functional roles in C. elegans chemosensation.

How can researchers distinguish between direct and indirect effects in srg-46 signaling pathways?

Distinguishing direct from indirect effects in srg-46 signaling requires a multifaceted experimental approach:

  • Acute Manipulation Strategies:

    • Implement optogenetic tools for precise temporal control of receptor activation

    • Use photoswitchable ligands for rapid and reversible receptor stimulation

    • Apply heat-shock inducible expression systems for temporal control

    • Compare immediate responses (seconds to minutes) with long-term adaptations (hours to days)

    • Monitor multiple signaling pathways simultaneously using multiplexed biosensors

  • Cell-Autonomous vs. Non-Autonomous Effects:

    • Perform cell-specific rescue experiments in srg-46 mutant backgrounds

    • Use cell-specific RNAi to knock down srg-46 in defined neuronal subsets

    • Implement mosaic analysis to create animals with mixed genotypes

    • Analyze non-cell-autonomous effects through paracrine signaling studies

    • Employ calcium imaging to track signal propagation through neural circuits

  • Direct Biochemical Evidence:

    • Conduct in vitro binding assays with purified components

    • Implement proximity labeling techniques (BioID, APEX) to identify direct interactors

    • Use FRET/BRET approaches to detect ligand-receptor and receptor-effector interactions

    • Perform co-immunoprecipitation under native conditions

    • Apply crosslinking strategies to capture transient interactions

  • Genetic Interaction Analysis:

    • Generate double mutants with genes in potential signaling pathways

    • Perform epistasis analysis to determine genetic relationships

    • Conduct suppressor and enhancer screens to identify pathway components

    • Create conditional alleles of pathway components for staged inactivation

    • Implement quantitative trait analysis for complex signaling networks

These approaches collectively enable researchers to distinguish between direct molecular interactions and downstream signaling consequences. The pluridimensional nature of GPCR signaling necessitates comprehensive investigation across multiple experimental paradigms, as receptors like srg-46 can signal through multiple pathways simultaneously, and different ligands may bias signaling toward specific pathways .

What are the most common pitfalls in srg-46 expression and functional studies?

Researchers studying srg-46 should be aware of several common pitfalls that can compromise experimental outcomes:

  • Expression System Challenges:

    • Inadequate membrane localization due to improper folding or trafficking

    • Aggregation in the endoplasmic reticulum or inclusion bodies

    • Post-translational modification differences between heterologous systems and native context

    • Degradation of the recombinant protein by host cell quality control mechanisms

    • Formation of non-physiological oligomers at high expression levels

  • Functional Assay Limitations:

    • False negatives due to testing limited signaling pathways

    • Overlooking ligand-specific bias toward untested pathways

    • Insufficient sensitivity for detecting weak interactions

    • Background activity from endogenous receptors in host cells

    • Artifacts from non-specific effects of high ligand concentrations

  • Data Interpretation Issues:

    • Overinterpreting promiscuous responses at non-physiological concentrations

    • Failing to distinguish between direct activation and allosteric modulation

    • Not accounting for receptor reserve in highly amplified pathways

    • Overlooking constitutive activity as a significant signaling mechanism

    • Misattributing effects to receptor activation when caused by off-target actions

  • C. elegans-Specific Challenges:

    • Functional redundancy with related chemoreceptors masking phenotypes

    • Environmental variables influencing receptor expression and function

    • Developmental compensation in mutant strains

    • Technical difficulties in performing electrophysiology on small C. elegans neurons

    • Challenges in distinguishing primary sensory effects from downstream behavioral consequences

The literature emphasizes that orphan GPCRs typically have uncharacterized signaling pathways, necessitating the use of promiscuous G proteins and multiple assay formats to comprehensively assess receptor function . Not all GPCRs couple efficiently to promiscuous G proteins or robustly induce β-arrestin recruitment, making a multifaceted screening approach essential for detecting genuine receptor-ligand interactions.

What quality control measures should be implemented when working with recombinant srg-46?

Rigorous quality control is essential when working with recombinant srg-46 to ensure reliable and reproducible results:

  • Expression Quality Assessment:

    • Verify full-length protein expression via Western blotting

    • Confirm proper glycosylation and post-translational modifications

    • Assess membrane localization using surface biotinylation or confocal microscopy

    • Quantify expression levels across different batches to ensure consistency

    • Evaluate receptor stability over time and storage conditions

  • Functional Validation:

    • Include positive control receptors in all functional assays

    • Perform concentration-response curves with reference compounds

    • Verify signal specificity using receptor antagonists when available

    • Test for expected G protein coupling profiles

    • Include controls for non-specific effects of vehicle solutions

  • Ligand Quality Control:

    • Confirm peptide ligand purity using HPLC and mass spectrometry

    • Verify correct disulfide bond formation and other post-translational modifications

    • Test stability of ligands in assay buffers at experimental time points

    • Prepare single-use aliquots to avoid freeze-thaw degradation

    • Include chemical validation for synthesized non-peptide compounds

  • Experimental Design Controls:

    • Implement blinding procedures for compound testing

    • Include technical replicates within experiments

    • Perform multiple independent biological replicates

    • Randomize plate positioning to control for edge effects

    • Use appropriate statistical methods with correction for multiple comparisons

QC ParameterMethodAcceptance CriteriaFrequency
Protein ExpressionWestern BlottingSingle band at expected MWEach preparation
Membrane LocalizationSurface Biotinylation>70% of protein at surfaceEach preparation
Functional ActivityReference Agonist ResponseEC50 within 3-fold of reference valueEach assay
Ligand PurityLC-MS>95% purityEach synthesis
Assay Z-factorStatistical calculation>0.5Each plate

Implementing these quality control measures helps ensure that experimental outcomes reflect true biological properties of srg-46 rather than artifacts of the expression system or assay conditions.

How should concentration-response data for potential srg-46 ligands be analyzed and interpreted?

Proper analysis of concentration-response data for srg-46 ligands requires rigorous mathematical approaches and careful interpretation:

  • Curve Fitting Methodology:

    • Use nonlinear regression with appropriate equations based on ligand behavior:

      • Four-parameter logistic (4PL) equation for standard sigmoidal responses

      • Five-parameter logistic (5PL) for asymmetrical curves

      • Operational model for partial agonists and calculation of signaling bias

    • Apply constraints based on biological plausibility (e.g., bottom asymptote ≥ 0)

    • Use global fitting across multiple experiments where appropriate

    • Report goodness-of-fit parameters (R², sum of squares, residual analysis)

  • Essential Parameters to Report:

    • Potency: EC50 or pEC50 (negative log of EC50) with confidence intervals

    • Efficacy: Emax as percentage of reference agonist with standard error

    • Basal activity: Baseline response indicating constitutive activity

    • Hill Slope: Indicator of cooperation or complex binding mechanisms

    • Time course parameters for kinetic experiments (onset rate, offset rate)

  • Statistical Analysis Requirements:

    • Perform at least three independent experiments with technical replicates

    • Use appropriate statistical tests for comparing curves (F-test) or parameters (t-test, ANOVA)

    • Apply correction for multiple comparisons when testing numerous compounds

    • Report variability measurements (SEM, 95% CI) for all parameters

    • Consider power analysis to ensure adequate sample size

  • Signaling Bias Quantification:

    • Calculate bias factors (ΔΔlog(τ/KA)) between different pathways

    • Use reference ligands and pathways for normalization

    • Present bias data in radar plots or heat maps for visual comparison

    • Include kinetic parameters in bias calculations when available

    • Consider system bias (observation bias) vs. true ligand bias

When interpreting concentration-response data, researchers should remember that GPCR signaling can appear different depending on the signal pathway, cell type, and time course investigated . The pluridimensional nature of GPCR signaling and the ability of ligands to bias their stimulus toward specific pathways necessitates parallel analysis of multiple signaling outcomes to fully characterize ligand pharmacology.

What emerging technologies might advance srg-46 characterization in the next five years?

Several cutting-edge technologies are poised to transform srg-46 research in the coming years:

  • Advanced Structural Biology Approaches:

    • Cryo-electron microscopy for determining srg-46 structure in different conformational states

    • Hydrogen-deuterium exchange mass spectrometry to map ligand binding sites

    • Single-particle analysis of receptor complexes with signaling partners

    • Molecular dynamics simulations in complex membrane environments

    • Integration of AlphaFold2-predicted structures with experimental validation

  • Next-Generation Functional Genomics:

    • Prime editing for precise genomic modifications without double-strand breaks

    • RNA-guided base editors for introducing point mutations without donor templates

    • Single-cell multi-omics to correlate transcriptome, proteome, and functional states

    • Spatial transcriptomics to map receptor expression in intact tissue contexts

    • Long-read sequencing to resolve complex genomic regions and splice variants

  • Advanced Imaging Technologies:

    • Lattice light-sheet microscopy for 3D visualization of receptor trafficking

    • Super-resolution microscopy (PALM/STORM) for nanoscale receptor organization

    • Expansion microscopy to physically enlarge samples for improved resolution

    • Multiplexed ion beam imaging for simultaneous visualization of dozens of proteins

    • Correlative light and electron microscopy to link function with ultrastructure

  • Microfluidic and Organ-on-Chip Systems:

    • Automated high-throughput screening platforms for C. elegans phenotyping

    • Controlled chemical gradient systems for precise chemosensory stimulation

    • Integrated electrophysiology and calcium imaging in microfluidic devices

    • Connected organ-on-chip systems to study intercellular communication

    • Single-synapse analysis platforms for neuronal signaling studies

  • Artificial Intelligence Applications:

    • Deep learning for behavioral phenotyping and classification

    • AI-powered virtual screening for novel srg-46 ligands

    • Neural networks for predicting receptor-ligand interactions

    • Automated image analysis for high-content screening

    • Systems biology modeling of complex signaling networks

These technologies will collectively enable more comprehensive characterization of srg-46, from detailed structural insights to complex in vivo functions, significantly accelerating our understanding of this receptor's role in C. elegans biology and potentially revealing principles applicable to human GPCR signaling systems.

How might comparative genomics inform evolutionary insights about srg-46?

Comparative genomics offers powerful approaches for understanding srg-46 evolution and function through cross-species analysis:

  • Phylogenetic Analysis of Receptor Evolution:

    • Trace srg-46 orthologs across nematode species and other phyla

    • Map evolutionary rates of different receptor domains (ligand binding vs. signaling)

    • Identify conserved motifs that may be critical for receptor function

    • Calculate selection pressures (dN/dS ratios) to identify positions under positive selection

    • Reconstruct ancestral sequences to determine evolutionary trajectory

  • Ligand-Receptor Coevolution Studies:

    • Examine coordinated evolution between srg-46 and potential ligand precursors

    • Identify cases of ligand switching or receptor repurposing during evolution

    • Compare evolutionary rates between receptors and ligands across lineages

    • Research confirms that peptides and GPCRs have coevolved, with ligands being more adaptive than receptors in shaping new signaling systems

    • This evolutionary pattern suggests higher pressure to conserve receptor function compared to ligand structure

  • Genomic Context Analysis:

    • Examine chromosomal clustering with functionally related genes

    • Study expansion patterns of the srg gene family across species

    • Identify conserved regulatory elements through phylogenetic footprinting

    • Analyze synteny to reveal evolutionary history of receptor gene loci

    • Investigate horizontal gene transfer events as potential sources of novel receptors

  • Functional Evolutionary Studies:

    • Test cross-species receptor activation with potential ligands

    • Perform chimeric receptor studies to identify domains responsible for specificity

    • Investigate convergent evolution in chemosensory systems across distantly related organisms

    • Reconstruct ancient receptor proteins to study functional evolution experimentally

    • Correlate receptor diversity with ecological niches across nematode species

These comparative approaches provide context for understanding srg-46 beyond its role in C. elegans, revealing evolutionary constraints and adaptations that shape chemosensory receptor function across species. The higher conservation of the receptor repertoire compared to peptide ligands (average J = 0.64 versus 0.49) suggests fundamental differences in evolutionary flexibility between these signaling components .

What interdisciplinary approaches might yield new insights into srg-46 function?

Innovative interdisciplinary approaches can provide novel perspectives on srg-46 function by integrating diverse methodologies:

  • Systems Biology and Network Analysis:

    • Map the complete interactome of srg-46 using proteomics and genetic screens

    • Develop mathematical models of srg-46 signaling networks

    • Apply graph theory to identify key nodes in receptor-mediated pathways

    • Integrate transcriptomic, proteomic, and metabolomic data sets

    • Simulate perturbations to predict system-level responses to receptor activation

  • Chemical Biology and Chemoinformatics:

    • Design activity-based probes for srg-46 ligand discovery

    • Apply fragment-based approaches to develop novel modulators

    • Implement chemical genetics to create orthogonal receptor-ligand pairs

    • Utilize chemoinformatic analysis to identify structural features of active compounds

    • Develop photoaffinity labels to capture transient receptor-ligand complexes

  • Synthetic Biology Applications:

    • Create synthetic signaling circuits incorporating srg-46

    • Engineer receptor variants with altered specificity or coupling properties

    • Develop biosensors based on srg-46 for detecting environmental chemicals

    • Design minimal systems for reconstituting receptor function in heterologous contexts

    • Implement optogenetic control of receptor activation for precise spatial and temporal studies

  • Ecological and Environmental Biology:

    • Study srg-46 function in natural C. elegans isolates from diverse habitats

    • Identify natural ligands from soil microbiome or plant sources

    • Examine receptor adaptation to different ecological niches

    • Investigate climate or geographical influences on receptor variation

    • Analyze co-evolution with microbial communities in natural settings

  • Translational Research Connections:

    • Apply insights from srg-46 deorphanization strategies to human orphan GPCRs

    • Explore potential applications in parasitic nematode control

    • Develop screening platforms for anthelmintic discovery

    • Create model systems for studying GPCR signaling disorders

    • Implement drug discovery approaches based on nematode receptor mechanisms

These interdisciplinary approaches extend beyond traditional molecular biology methods and have the potential to reveal unexpected aspects of srg-46 function, placing this receptor in broader biological, ecological, and evolutionary contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.