Recombinant Serpentine receptor class gamma-47 (srg-47)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them during order placement. We will prepare the product according to your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
srg-47; C53A5.8; Serpentine receptor class gamma-47; Protein srg-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
srg-47
Target Protein Sequence
MSEILIVPLKEKMSERTLWLTIVQMFYGTITVVFMLILLFLFQFSKKFSYSFYRILQLDL ITNILCNLNSLFSVRFQNHLMFLPVLEFLENSIPGFLSISSRGKFLFFHLQFFTALSMNI HRISSVTHPVGHGEFWTKYFKLYYVILCGISIFFTSVLPLESHRIEMENGTLIEISNHSM TTWTLNIYAIYSSVYFIILLLVGIISIFYISRKVEQVSTRSREVARKLSLITLVYGFLYS GILLWSILMALNRYFQFCPPSFGYIFNMSLGISSDLITLSLPYILLIFDVGIRKLFCRKR RKVGAMNVP
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_C53A5.8

STRING: 6239.C53A5.8

UniGene: Cel.26180

Protein Families
Nematode receptor-like protein srg family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is srg-47 and where is it primarily expressed in C. elegans?

Serpentine receptor class gamma-47 (srg-47) is a G protein-coupled receptor (GPCR) encoded by the gene srg-47 (ORF name: C53A5.8) in Caenorhabditis elegans. This receptor is primarily expressed in ASI chemosensory neurons, which are critical regulators of dauer formation and other sensory functions in C. elegans . The protein consists of 309 amino acids and functions in pheromone detection and sensory transduction pathways that regulate development and behavior in the nematode.

How does srg-47 fit into the broader context of serpentine receptors in nematodes?

Serpentine receptors in C. elegans form one of the largest gene families in the nematode genome, with srg-47 belonging to the class gamma subfamily. These GPCRs play diverse roles in chemosensation, development, and behavior. Within the context of G protein signaling cascades, srg-47 is part of a specialized subset of receptors expressed in the ASI sensory neurons that are involved in detecting environmental signals that regulate developmental decisions, particularly dauer formation. The srg family shows structural homology to other GPCR families but has evolved specific functions in nematode-specific sensory processes .

How can the srg-47 promoter be effectively used in gene expression studies?

The srg-47 promoter (approximately 0.65 kb in length) provides highly selective expression in ASI chemosensory neurons, making it an excellent tool for ASI-specific gene expression studies . Researchers have successfully used this promoter in several experimental contexts:

  • For rescue experiments: The srg-47 promoter has been used to drive expression of genes specifically in ASI neurons. For example, an srg-36 cDNA driven by the ASI-selective srg-47 promoter successfully rescued C3-induced dauer formation in LSJ2-N2 NIL strains .

  • For visualization studies: The promoter can be used to drive fluorescent reporter expression (such as GFP or mCherry) specifically in ASI neurons to monitor their morphology or activity.

  • For functional studies: Expression of GCaMP calcium indicators under srg-47 promoter control enables visualization of ASI neuron activity in response to stimuli .

The key advantage of this promoter is its high specificity for ASI neurons, allowing targeted manipulation of gene expression in this important sensory neuron pair.

What are the optimal conditions for expressing recombinant srg-47 in E. coli?

Recombinant srg-47 has been successfully expressed in E. coli with the following considerations:

ParameterOptimal ConditionNotes
Expression SystemE. coliUsed for full-length protein (1-309 aa)
VectorpET series or pGEXHis-tagged constructs commonly used
Temperature18-25°CLower temperature reduces inclusion body formation
Induction0.1-0.5 mM IPTGGradual induction preferred
BufferTris-based with 50% glycerolOptimized for protein stability
Storage-20°C or -80°C for extended storageWorking aliquots can be stored at 4°C for up to one week

The recombinant protein should be used with caution as repeated freezing and thawing is not recommended. For membrane proteins like srg-47, solubilization strategies using mild detergents may be necessary to maintain functional conformation .

How does srg-47 contribute to neural circuits involved in C. elegans behavior?

srg-47 expression in ASI neurons plays a role in multiple neural circuits that modulate C. elegans behavior:

  • Dauer formation pathway: ASI neurons are primary regulators of dauer formation, and srg-47-expressing neurons integrate environmental signals to control this developmental decision .

  • Pathogen response circuits: Recent research (2025) has shown that srg-47-expressing neurons are involved in pathogen-induced sickness behaviors. GCaMP7f expressed under the srg-47 promoter has been used to monitor ASI neuron activity during Pseudomonas aeruginosa infection, revealing that these neurons contribute to behavioral changes during infection, including reduced feeding rates .

  • Neuromodulatory systems: ASI neurons expressing srg-47 are connected to stress and satiety regulation systems, forming part of the neural circuits that coordinate physiological and behavioral responses to environmental challenges .

The exact signaling mechanisms downstream of srg-47 are still being investigated, but they likely involve integration with other GPCRs and subsequent modulation of neurotransmitter and neuropeptide release.

What is the role of srg-47 in relation to other ASI-expressed serpentine receptors in pheromone sensing?

srg-47 functions alongside other serpentine receptors in ASI neurons, particularly in pheromone detection and response:

  • Cooperative receptor function: srg-47 is expressed in the same neurons as srg-36 and srg-37, which are known to mediate responses to the ascaroside pheromone C3 (ascr#5). These receptors work in parallel or cooperative pathways to detect different components of the complex pheromone mixture that C. elegans uses for communication .

  • Developmental regulation: In dauer formation, srg-47-expressing ASI neurons integrate signals from multiple receptor types, including the SRG-36/SRG-37 receptors that directly sense ascaroside pheromones. Mutations affecting crh-1 (CREB homolog) can be rescued by expression under the srg-47 promoter, indicating the importance of this signaling pathway in ASI neurons .

  • Receptor localization: SRG-47 and related receptors are primarily localized in the sensory cilia of ASI neurons, where they can directly interact with environmental chemicals. This localization is critical for their function in sensory transduction .

Research suggests that these receptors have evolved specific roles in detecting particular ascarosides or other environmental signals, with srg-47 potentially responding to unique ligands or modulating the response of other receptors.

How can researchers effectively use srg-47 promoter-driven calcium imaging to study ASI neuron function?

Calcium imaging of ASI neurons using the srg-47 promoter has become a valuable technique for studying neuronal activity:

  • Construct design: Generate a construct with GCaMP7f (or other calcium indicator) under control of the srg-47 promoter (0.65 kb) to achieve specific expression in ASI neurons .

  • Transgenic animal creation: Use standard microinjection techniques to create stable transgenic lines expressing the calcium indicator. For confirmatory experiments, researchers have generated strains with cell-specific expression of GCaMP7f in ASI under the srg-47 promoter .

  • Imaging setup:

    • Immobilize animals on agarose pads with polystyrene beads

    • Use a spinning disk confocal microscope or similar setup for high-speed imaging

    • Record baseline activity for 30 seconds before stimulus application

    • Apply stimulus solutions using microfluidic devices for precise temporal control

  • Analysis methods:

    • Measure fluorescence intensity changes (ΔF/F0) in the cell body of ASI neurons

    • Compare responses between different genetic backgrounds or stimulus conditions

    • Use automated tracking software to maintain focus on neurons during recording

This approach has been used successfully to monitor ASI neuron responses to pathogen infection and other stimuli, providing insights into the neural basis of C. elegans behaviors .

What approaches are most effective for studying srg-47 interactions with downstream signaling components?

To investigate srg-47 signaling pathways, researchers can employ several complementary approaches:

  • Heterologous expression systems:

    • Express srg-47 in HEK293 cells or similar mammalian cell lines

    • Measure second messenger production (e.g., calcium, cAMP) in response to potential ligands

    • Use BRET or FRET techniques to detect protein-protein interactions with G proteins

  • In vivo genetic approaches:

    • Create mutations in potential downstream signaling components

    • Express dominant negative or constitutively active signaling molecules under the srg-47 promoter

    • Use cell-specific RNAi to knock down signaling components specifically in ASI neurons

  • Biochemical approaches:

    • Perform co-immunoprecipitation using tagged versions of srg-47

    • Use proximity labeling methods like BioID to identify proteins in close proximity to srg-47

    • Conduct phosphoproteomic analysis to identify downstream phosphorylation events

  • Gain-of-function experiments:

    • Express srg-47 in other sensory neurons (e.g., ASH) that mediate different behaviors

    • Test whether srg-47 expression confers new ligand responsiveness

    • Use calcium imaging to visualize responses to potential ligands

Researchers have successfully used this approach to demonstrate that expression of srg-36 or srg-37 in ASH neurons confers responsiveness to the C3 ascaroside, suggesting a similar approach could be valuable for srg-47 .

How can CRISPR-Cas9 genome editing be optimized for modifying the srg-47 locus?

For efficient CRISPR-Cas9 editing of the srg-47 locus in C. elegans, researchers should consider the following protocol:

  • Guide RNA (gRNA) design:

    • Select target sites with minimal off-target potential using tools like CRISPRdirect

    • Choose sites near the start codon for knock-ins or gene disruption

    • Verify guide RNA efficiency using in silico prediction tools

  • Repair template design:

    • For fluorescent tagging: Design homology arms (>500 bp each) flanking the insertion site

    • For promoter studies: Create precise deletions or modifications of the 0.65 kb promoter region

    • Include selection markers (e.g., roller phenotype) for easier screening

  • Delivery method:

    • Microinject young adult hermaphrodites with:

      • Cas9 protein (10-25 μg/μl)

      • sgRNA (100-200 ng/μl)

      • Repair template (50-100 ng/μl)

      • Co-injection markers

  • Screening strategy:

    • Use PCR to identify potential edit events

    • Verify edits by sequencing

    • Assess expression patterns or functional consequences

  • Validation experiments:

    • Confirm that modified srg-47 maintains expected expression pattern in ASI neurons

    • Test whether functional properties are maintained or altered as predicted

    • Compare phenotypes with traditional mutants or transgenic overexpression lines

This approach allows precise modification of the srg-47 locus while maintaining its native regulatory context, providing advantages over traditional transgenic approaches for studying this receptor's function.

How should researchers interpret contradictory findings regarding srg-47 function across different experimental paradigms?

When encountering contradictory results regarding srg-47 function, researchers should systematically evaluate:

  • Context-dependent effects:

    • ASI neurons integrate multiple signals, so srg-47 function may vary depending on environmental conditions

    • Different developmental stages may show distinct srg-47 functions

    • Interaction with other co-expressed receptors may alter apparent function

  • Technical considerations:

    • Expression level differences between studies (overexpression vs. endogenous)

    • Fusion tags may affect protein localization or function

    • Background strain differences can influence phenotypes

  • Resolution strategies:

    • Conduct epistasis experiments to place srg-47 in signaling pathways

    • Use temporally controlled expression systems to disambiguate developmental vs. acute effects

    • Employ single-cell transcriptomics to identify context-dependent co-factors

  • Integration with broader literature:

    • Compare findings with related serpentine receptors (e.g., srg-36, srg-37)

    • Consider evolutionary conservation of signaling pathways

    • Examine effects in different behavioral or physiological assays

By systematically addressing these factors, researchers can develop more nuanced models of srg-47 function that reconcile apparently contradictory findings .

What are the latest findings regarding the evolutionary conservation of srg-47 and related receptors?

Recent research on the evolutionary aspects of srg-47 and related serpentine receptors has revealed:

  • Nematode-specific adaptations:

    • The srg family appears to have undergone significant expansion specifically in nematode lineages

    • Different Caenorhabditis species show distinct patterns of conservation and diversification

    • Parallel evolution has occurred in domesticated Caenorhabditis species, targeting these receptors

  • Functional conservation:

    • While sequence conservation may be limited, functional roles in sensory neurons are often preserved

    • Expression patterns in homologous neurons are more conserved than sequence identity

    • Similar signaling pathways downstream of these receptors are maintained across species

  • Adaptive significance:

    • Changes in srg family receptors correlate with ecological adaptations

    • Laboratory-adapted strains show specific modifications to these receptors

    • Independent deletion events affecting related receptors (e.g., srg-36 and srg-37) have occurred in different strains

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.