Recombinant Serpentine receptor class gamma-53 (srg-53)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of srg-53

The srg-53 gene (Entrez Gene ID: 187980) encodes the Serpentine receptor class gamma-53 protein, a 295-amino acid transmembrane protein involved in sensory perception and intercellular signaling in C. elegans.

Key Features:

  • Gene Structure:

    • Two mRNA variants (NM_070947.1 and NM_070947.2) encode the same protein product (NP_503348.1) .

    • The coding sequence (CDS) spans 888 base pairs, with sequence updates documented as of 2019 .

PropertyDetail
OrganismCaenorhabditis elegans
Protein NameSerpentine receptor class gamma-53
UniProt IDO16974
Gene TypeProtein-coding
mRNA AccessionNM_070947.1, NM_070947.2
Protein AccessionNP_503348.1

Sequence Information:

Recombinant Production Methods

Recombinant srg-53 is synthesized using cDNA ORF clones optimized for transient expression.

Cloning and Vector Details:

  • Clone ID: OCa347811

  • Vector: pcDNA3.1+/C-(K)DYK (default) or custom vectors .

  • Tag: C-terminal DYKDDDDK epitope tag for detection and purification .

  • Cloning Technology: CloneEZ™ Seamless cloning ensures high-fidelity insertion .

ParameterSpecification
Insert Length888 bp
Insert StructureLinear
Stop Codon HandlingDeleted in pcDNA3.1+/C-(K)DYK vectors
Sequence ValidationCurated by WormBase (RefSeq)

Product Details:

  • Expression System: Recombinant protein produced in C. elegans .

  • Storage:

    • Short-term: -20°C in Tris-based buffer with 50% glycerol .

    • Long-term: -80°C; avoid repeated freeze-thaw cycles .

PropertyDetail
Catalog NumberCSB-CF517699CXY
Quantity50 µg (customizable)
PurityOptimized via Tris-based buffer
ApplicationELISA, ligand-binding assays

Research Applications and Implications

Recombinant srg-53 is primarily used to study:

  1. Chemosensory Pathways: Investigating GPCR-mediated signaling in C. elegans .

  2. Ligand-Receptor Interactions: Structural analysis of the serpentine receptor family .

  3. Comparative Genomics: Evolutionary studies of nematode sensory systems .

Quality Control and Validation

  • Sequence Accuracy: Verified against WormBase annotations (RefSeq NM_070947.2) .

  • Functional Testing: Validated via immunoblotting and ligand-binding assays .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a useful reference for your own preparations.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. To prioritize a specific tag, please indicate your preference during ordering.
Synonyms
srg-53; T02B11.1; Serpentine receptor class gamma-53; Protein srg-53
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-295
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
srg-53
Target Protein Sequence
MLPLTKIWLCYGIFSAILMIFMIVLLSVSKHFTNSFYRVITMDIILNLLCWVNTWPSRMV FREDGFGFARFLYEFYNKSFDVSFFLSNVFFHVQSASTICICCHRLSTAIFDNSNRFWSR FYLLVYALIILYSFLAVQLLYRAPIKFDYELNKFYSEPATLDQRLSVAMYLRCFMSGYLL AIIIIALSTLYQVRKRIAPFDHLHKNLLRKMSLIAFSHTFVFTMLLAWQTLNSFVVYASF IELLMIVSDMISFSMAYILLIFDGNVRSVIKNNLPVIQINGRRISDAQRSQNNIT
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_T02B11.1

UniGene: Cel.2531

Protein Families
Nematode receptor-like protein srg family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Serpentine receptor class gamma-53 (srg-53) and what is its structural composition?

Serpentine receptor class gamma-53 (srg-53) is a G protein-coupled receptor (GPCR) found in Caenorhabditis elegans. According to protein sequence data, srg-53 consists of 295 amino acids with the complete sequence beginning with mLPLTKIWLCYGIFSAILMIFMIVLLSVSKH and continuing through to the C-terminal sequence ending with QNNIT . The protein contains multiple transmembrane domains characteristic of serpentine receptors, with hydrophobic regions that span the cell membrane. The structural analysis indicates srg-53 belongs to the broader family of chemosensory receptors that play crucial roles in C. elegans sensory perception and environmental responses. When designing experiments, researchers should consider the membrane-bound nature of this protein and its native conformation when selecting expression systems and purification strategies.

What expression systems are most effective for producing recombinant srg-53?

For recombinant srg-53 production, the choice of expression system depends significantly on research objectives. Based on structural characteristics similar to other serpentine receptors, E. coli systems may be suitable for producing partial domains for structural studies, but often struggle with full-length membrane proteins. For functional studies requiring properly folded protein, eukaryotic systems including yeast (P. pastoris), insect cells (Sf9, High Five), or mammalian cell lines (HEK293, CHO) generally yield better results with appropriate post-translational modifications. When using bacterial systems, fusion tags such as MBP or SUMO can improve solubility. For higher protein yields, insect cell expression systems using baculovirus vectors have demonstrated success with similar GPCRs from C. elegans. Researchers should monitor expression using Western blot analysis with antibodies against either srg-53 or the affinity tag used for purification.

How should researchers optimize buffer conditions for srg-53 stability?

Optimizing buffer conditions is critical for maintaining srg-53 stability during purification and storage. Based on information from similar membrane proteins, recommended starting buffer conditions include Tris-based buffers (20-50 mM, pH 7.5-8.0) supplemented with glycerol, which has been shown to improve stability . The protein is typically stored in solutions containing 50% glycerol at -20°C to maintain functionality . For detergent selection, mild non-ionic detergents (DDM, LMNG, or OG) at concentrations just above their critical micelle concentration (CMC) typically provide the best membrane protein stability. Additionally, including protease inhibitors (PMSF, EDTA, or commercial cocktails) is essential to prevent degradation. Thermal shift assays (TSA) and size exclusion chromatography with multi-angle light scattering (SEC-MALS) can help determine optimal buffer conditions that maintain protein stability and prevent aggregation.

What functional assays can be employed to characterize srg-53 activity in vitro?

Characterizing the functional activity of srg-53 in vitro requires specialized assays that account for its membrane receptor nature. Several methodological approaches can be employed:

  • Ligand binding assays: Radioligand binding or fluorescence-based assays using potential ligands to measure binding affinity and kinetics.

  • GTPγS binding assay: To assess G-protein coupling and activation, measuring the exchange of GDP for GTP upon receptor activation.

  • Calcium mobilization assays: Using calcium-sensitive dyes in cells expressing srg-53 to detect intracellular calcium flux following receptor activation.

  • Surface plasmon resonance (SPR): For real-time analysis of binding interactions between purified srg-53 and potential binding partners.

  • Bioluminescence resonance energy transfer (BRET): To study protein-protein interactions involving srg-53 in living cells.

When designing these assays, it is important to include appropriate positive and negative controls, as well as concentration-response analyses to determine EC50/IC50 values. Experiments should be conducted at physiologically relevant temperatures, with careful consideration of the detergent environment for solubilized receptor studies.

How can researchers effectively study srg-53 function in C. elegans models?

Studying srg-53 function in C. elegans requires integration of molecular, genetic, and behavioral approaches:

  • Gene knockout/knockdown: CRISPR-Cas9-mediated gene editing or RNAi to create srg-53 loss-of-function models. Phenotypic analysis should include chemotaxis, foraging behavior, and lifespan studies.

  • Reporter gene assays: Creating transgenic worms with srg-53 promoter::GFP fusions to study expression patterns and regulation.

  • Cell-specific rescue: Expressing wild-type srg-53 in specific neurons of knockout worms to determine cell-autonomous functions.

  • Calcium imaging: Using GCaMP or similar indicators in neurons expressing srg-53 to visualize neural activity in response to putative ligands.

  • Behavioral assays: Quantifying chemotaxis, locomotion, or feeding behaviors in response to environmental stimuli that may be sensed through srg-53.

When analyzing results, researchers should apply appropriate statistical methods, control for genetic background effects, and consider developmental timing in their experimental design, as GPCR expression and function may vary throughout the worm's life cycle.

What approaches should be used to identify potential ligands for srg-53?

Identifying ligands for orphan receptors like srg-53 remains one of the most challenging aspects of GPCR research. Methodological approaches include:

  • In silico screening: Computational docking studies using homology models of srg-53 to screen compound libraries for potential binding partners.

  • Deorphanization assays: Heterologous expression of srg-53 in cell lines coupled with high-throughput functional assays (calcium flux, cAMP production) to screen compound libraries.

  • Metabolomics approaches: Comparative metabolomic analysis of wild-type and srg-53 mutant C. elegans to identify differentially processed metabolites.

  • Behavioral screening: Testing C. elegans responses to chemically defined libraries, comparing wild-type and srg-53 mutants.

  • Reverse pharmacology: Testing compounds known to activate related receptors or compounds present in the natural environment of C. elegans.

Results should be validated through dose-response curves and competitive binding assays, with confirmation in multiple assay systems. Researchers should prioritize physiologically relevant candidate ligands based on the neural expression pattern of srg-53 and known sensory functions of the expressing neurons.

What strategies can address low expression yields of recombinant srg-53?

Membrane proteins like srg-53 often present expression challenges. To improve yields, researchers should consider:

  • Codon optimization: Adjusting the srg-53 coding sequence for the expression host to improve translation efficiency.

  • Fusion partners: Incorporating solubility-enhancing tags such as SUMO, MBP, or Trx at the N-terminus while avoiding disruption of signal sequences.

  • Expression conditions optimization: Systematic variation of temperature, induction timing, and inducer concentration. For membrane proteins, lower temperatures (16-25°C) often improve folding.

  • Chaperone co-expression: Co-expressing molecular chaperones to assist proper folding.

  • Culture media optimization: Using enriched media or supplementing with specific amino acids and vitamins.

  • Construct design: Creating truncated versions or chimeric constructs with well-expressed homologous receptors.

Researchers should implement a systematic approach, testing multiple variables in small-scale cultures before scaling up, and quantify protein expression using both total protein analysis and functional assays to ensure the expressed protein is correctly folded.

How can researchers differentiate between srg-53 and other serpentine receptors in functional studies?

Ensuring specificity in srg-53 studies requires several methodological approaches:

  • Sequence-specific targeting: Using highly specific sgRNAs for CRISPR-Cas9 editing or siRNAs that target unique regions of srg-53 mRNA.

  • Receptor-selective antibodies: Developing antibodies against unique epitopes, particularly in the N-terminal or C-terminal regions or extracellular loops that differ from related receptors.

  • Domain swapping experiments: Creating chimeric receptors to identify domains responsible for specific functions.

  • Pharmacological profiling: Developing a panel of compounds with differential activity across related receptors.

  • Expression profiling validation: Using single-cell RNA sequencing to confirm the cellular expression pattern of srg-53 versus related receptors.

When publishing results, researchers should include extensive controls demonstrating specificity, including genetic rescue experiments and comparison with closely related receptors to establish that observed phenotypes are specifically attributable to srg-53.

What are the best practices for analyzing and presenting srg-53 research data?

When analyzing and presenting srg-53 research data, adherence to rigorous standards helps ensure reproducibility and clarity:

When reporting negative results, provide comprehensive details about experimental conditions and power calculations to help other researchers avoid similar unproductive approaches.

How might srg-53 research contribute to our understanding of human GPCRs and disease mechanisms?

While srg-53 is specific to C. elegans, comparative studies with human GPCRs can yield valuable insights:

  • Evolutionary conservation: Analyzing structural and functional conservation between srg-53 and human GPCRs can identify fundamental mechanisms of receptor activation and signal transduction.

  • Disease modeling: Although distinct from human surfactant-related genes (SRGs) associated with lung cancer , the mechanistic insights from studying GPCR function in simple organisms can inform understanding of human GPCR dysfunction in disease.

  • Drug discovery platforms: The simpler C. elegans system allows high-throughput screening approaches that may identify novel mechanisms for GPCR modulation potentially applicable to human targets.

  • Signaling pathway elucidation: Identifying downstream effectors of srg-53 in C. elegans may reveal conserved GPCR signaling components relevant to human biology.

Researchers pursuing translational aspects should clearly distinguish between findings directly applicable to human systems versus model-specific observations, while highlighting conserved mechanisms of receptor function, regulation, and signal transduction.

What emerging technologies are advancing srg-53 research?

Several cutting-edge technologies are transforming research capabilities for studying membrane receptors like srg-53:

  • Cryo-electron microscopy: Enabling structural determination of membrane proteins without crystallization, potentially revealing srg-53 conformational states.

  • Optogenetics and chemogenetics: Allowing precise temporal control of srg-53-expressing neurons to correlate receptor activation with behavioral outputs.

  • CRISPR-based techniques: Beyond knockout studies, CRISPR interference (CRISPRi) and activation (CRISPRa) enable fine-tuned modulation of srg-53 expression.

  • Nematode-on-a-chip microfluidics: Facilitating high-throughput screening of behavioral responses in srg-53 mutants under controlled chemical environments.

  • AlphaFold2 and related AI approaches: Providing increasingly accurate structural predictions for orphan receptors like srg-53, guiding experimental design.

Researchers adopting these technologies should develop standardized protocols specific to srg-53, validate results through complementary approaches, and consider forming collaborative networks to share specialized resources and expertise.

What are the most effective purification strategies for obtaining high-quality recombinant srg-53?

Purifying membrane proteins like srg-53 requires specialized approaches:

  • Affinity chromatography: Utilizing poly-histidine, FLAG, or other affinity tags positioned to avoid interference with protein function. Two-step purification combining affinity and size exclusion chromatography typically yields the highest purity.

  • Detergent selection: Screening multiple detergents, including newer amphipols and nanodiscs that better maintain native conformation.

  • Purification conditions: Optimizing temperature, pH, and salt concentration through systematic testing. Adding stabilizing agents like glycerol (50%) has been reported to enhance stability .

  • Quality control measures: Implementing multi-angle light scattering, circular dichroism, and thermal shift assays to assess protein homogeneity, folding, and stability.

  • Scale-up considerations: Developing protocols that maintain protein quality when scaling from analytical to preparative quantities.

A typical protocol might begin with membrane isolation, followed by solubilization in selected detergent, primary affinity purification, tag cleavage if desired, and final polishing via size exclusion chromatography. Each step should be validated for retention of native conformation and biological activity.

How should researchers design experiments to study srg-53 interactions with other proteins?

Investigating protein interaction networks involving srg-53 requires multiple complementary approaches:

  • Co-immunoprecipitation: Using antibodies against srg-53 or potential interacting partners, followed by mass spectrometry identification of co-precipitated proteins.

  • Yeast two-hybrid assays: Modified for membrane proteins using split-ubiquitin systems to identify potential interactors.

  • Proximity labeling: Employing BioID or APEX2 fusions with srg-53 to identify proteins in close proximity in living cells.

  • FRET/BRET assays: For real-time analysis of protein interactions in living cells.

  • Surface plasmon resonance or microscale thermophoresis: For quantitative binding analysis of purified components.

Researchers should design controls that account for non-specific interactions common with membrane proteins and validate key interactions through multiple independent methods. When reporting interactions, quantitative parameters including affinity constants, association/dissociation rates, and stoichiometry should be included when possible.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.